DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E5 and NKX6-2

DIOPT Version :9

Sequence 1:NP_524825.1 Gene:E5 / 45396 FlyBaseID:FBgn0008646 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_796374.2 Gene:NKX6-2 / 84504 HGNCID:19321 Length:277 Species:Homo sapiens


Alignment Length:214 Identity:72/214 - (33%)
Similarity:91/214 - (42%) Gaps:42/214 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   224 VPTGPPHGPHPHLPPGQIPLGIFPGGPHPGHPPPHGHHP-----FGSAPHLIRDSYPLYPWLLSR 283
            :|.|.|||....|  |: |:|...||...|.|..:|...     ||.|..:.|.    ||..|:.
Human    52 LPLGTPHGISDIL--GR-PVGAAGGGLLGGLPRLNGLASSAGVYFGPAAAVARG----YPKPLAE 109

  Fly   284 -HGR--IFPRFPGNFLFQPFRKP------------------KRVRTAFSPTQLLKLEHAFEGNHY 327
             .||  ||  :||.....|:|.|                  |..|..||..|:..||..||...|
Human   110 LPGRPPIF--WPGVVQGAPWRDPRLAGPAPAGGVLDKDGKKKHSRPTFSGQQIFALEKTFEQTKY 172

  Fly   328 VVGAERKQLAQGLSLTETQVKVWFQNRRTKHKRMQQEGGDGSDTKSNKGSSSGGGGGGDGEDDAK 392
            :.|.||.:||..|.:||:||||||||||||.::........:..|.:..:.....||.|.|||  
Human   173 LAGPERARLAYSLGMTESQVKVWFQNRRTKWRKRHAVEMASAKKKQDSDAEKLKVGGSDAEDD-- 235

  Fly   393 HDGSQHSYEDAEDPEDEDE 411
                 ..|....||..:||
Human   236 -----DEYNRPLDPNSDDE 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E5NP_524825.1 Homeobox 307..359 CDD:278475 29/51 (57%)
NKX6-2NP_796374.2 Repressor domain. /evidence=ECO:0000250|UniProtKB:D3Z4R4 89..142 16/58 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 132..155 2/22 (9%)
Homeobox 151..204 CDD:306543 29/52 (56%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 210..250 12/47 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0850
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.