DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E5 and HB51

DIOPT Version :10

Sequence 1:NP_524825.1 Gene:E5 / 45396 FlyBaseID:FBgn0008646 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_195999.2 Gene:HB51 / 831723 AraportID:AT5G03790 Length:235 Species:Arabidopsis thaliana


Alignment Length:76 Identity:28/76 - (36%)
Similarity:40/76 - (52%) Gaps:8/76 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   290 RFPGNFLFQPFRKPKRVRTAFSPTQLLKLEHAFEGNHYVVGAERK-QLAQGLSLTETQVKVWFQN 353
            |||.|  .....|.||:.:.    ||..||.:|: ....:.::|| :|::.|.|...|:.|||||
plant    67 RFPNN--NNEMIKKKRLTSG----QLASLERSFQ-EEIKLDSDRKVKLSRELGLQPRQIAVWFQN 124

  Fly   354 RRTKHKRMQQE 364
            ||.:.|..|.|
plant   125 RRARWKAKQLE 135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E5NP_524825.1 Homeodomain 304..360 CDD:459649 20/56 (36%)
HB51NP_195999.2 Homeodomain 77..130 CDD:459649 21/57 (37%)
HALZ 132..166 CDD:460477 2/4 (50%)

Return to query results.
Submit another query.