DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E5 and HAT3

DIOPT Version :10

Sequence 1:NP_524825.1 Gene:E5 / 45396 FlyBaseID:FBgn0008646 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_191598.1 Gene:HAT3 / 825210 AraportID:AT3G60390 Length:315 Species:Arabidopsis thaliana


Alignment Length:60 Identity:23/60 - (38%)
Similarity:33/60 - (55%) Gaps:0/60 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   305 RVRTAFSPTQLLKLEHAFEGNHYVVGAERKQLAQGLSLTETQVKVWFQNRRTKHKRMQQE 364
            |.:...|..|.|.||..|:.:..:...::..||:.|:|...||:|||||||.:.|..|.|
plant   161 RKKLRLSKEQALVLEETFKEHSTLNPKQKMALAKQLNLRTRQVEVWFQNRRARTKLKQTE 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E5NP_524825.1 Homeodomain 304..360 CDD:459649 20/54 (37%)
HAT3NP_191598.1 HD-ZIP_N 19..118 CDD:461370
Homeodomain 161..215 CDD:459649 20/53 (38%)
HALZ 217..260 CDD:128634 2/4 (50%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.