DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E5 and Msx1

DIOPT Version :9

Sequence 1:NP_524825.1 Gene:E5 / 45396 FlyBaseID:FBgn0008646 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_112321.2 Gene:Msx1 / 81710 RGDID:620929 Length:303 Species:Rattus norvegicus


Alignment Length:262 Identity:80/262 - (30%)
Similarity:102/262 - (38%) Gaps:75/262 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 PSPPNAGGNPAAAGNTAKS-GDPSSGTGNPPTLIRPLPLPAPNLALIGNRTSPNAMAVRMAGPPH 187
            |:...||..|.||..||.: |....|.       :| .:||..|        |.::...||....
  Rat    24 PAGGGAGQAPGAAAATATAMGTDEEGA-------KP-KVPASLL--------PFSVEALMADHRK 72

  Fly   188 PPSQPPPFLAAQFQMAAALAHHHQQQQQQQQQQLPPVPTGPPHGPHPHL--PPGQIPLGIFPGGP 250
            |.::....:|::...||.                         |...||  .||.:      |.|
  Rat    73 PGAKESVLVASEGAQAAG-------------------------GSVQHLGTRPGSL------GAP 106

  Fly   251 H-PGHPPPHGHHPFGSAPHLIRDS---------YPLYPWLLSRHGRIFPRF---PGNFLFQP--- 299
            . |..|.|.||...|....|..|:         ....||:.|      |||   |...|..|   
  Rat   107 DAPSSPGPLGHFSVGGLLKLPEDALVKAESPEKLDRTPWMQS------PRFSPPPARRLSPPACT 165

  Fly   300 FRKPK---RVRTAFSPTQLLKLEHAFEGNHYVVGAERKQLAQGLSLTETQVKVWFQNRRTKHKRM 361
            .||.|   :.||.|:..|||.||..|....|:..|||.:.:..|||||||||:||||||.|.||:
  Rat   166 LRKHKTNRKPRTPFTTAQLLALERKFRQKQYLSIAERAEFSSSLSLTETQVKIWFQNRRAKAKRL 230

  Fly   362 QQ 363
            |:
  Rat   231 QE 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E5NP_524825.1 Homeobox 307..359 CDD:278475 29/51 (57%)
Msx1NP_112321.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0850
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.