DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E5 and Nkx6-3

DIOPT Version :9

Sequence 1:NP_524825.1 Gene:E5 / 45396 FlyBaseID:FBgn0008646 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_001102925.1 Gene:Nkx6-3 / 685102 RGDID:1597780 Length:262 Species:Rattus norvegicus


Alignment Length:252 Identity:74/252 - (29%)
Similarity:93/252 - (36%) Gaps:67/252 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   198 AQF-QMAAALAHHHQQQQQQQQQQLPPVPTGP------PHG-----PHPHLPPGQIPLGIFPGGP 250
            ||| :|.|.:.   |...|....:|.|...||      |||     ..|...|..   .:..|.|
  Rat    17 AQFSEMKAPMC---QYSVQNSFYKLSPPGLGPQLAAGTPHGITDILSRPVATPNS---SLLSGYP 75

  Fly   251 HPGHPPPHGHHPFGSAPHLIRDSYPLY--PWL--LSRHGRIFPRFPGNF---------------- 295
            |..        .||..     .|..:|  |.:  .|:.|..:|....|.                
  Rat    76 HVA--------GFGGL-----SSQGVYYGPQVGSFSKTGNEYPTRTRNCWADTGQDWRGSTRPCS 127

  Fly   296 -----LFQPFRKPKRVRTAFSPTQLLKLEHAFEGNHYVVGAERKQLAQGLSLTETQVKVWFQNRR 355
                 |.....|.|..|..|:..|:..||..||...|:.|.||.:||..|.:||:||||||||||
  Rat   128 NTPDPLSDTIHKKKHTRPTFTGHQIFALEKTFEQTKYLAGPERARLAYSLGMTESQVKVWFQNRR 192

  Fly   356 TK-HKRMQQEGGDGSDTKSNKGSSSGGGGGGDGEDDAKHDGSQHSYEDAEDPEDEDE 411
            || .|:...|  ..|.|....|.:||.....:.|||        .|....||:.:||
  Rat   193 TKWRKKSALE--PSSSTPRAPGGASGDRAASENEDD--------EYNKPLDPDSDDE 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E5NP_524825.1 Homeobox 307..359 CDD:278475 28/52 (54%)
Nkx6-3NP_001102925.1 Homeobox 143..197 CDD:395001 28/53 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0850
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X14
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.