DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E5 and Cdx2

DIOPT Version :9

Sequence 1:NP_524825.1 Gene:E5 / 45396 FlyBaseID:FBgn0008646 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_076453.1 Gene:Cdx2 / 66019 RGDID:621234 Length:310 Species:Rattus norvegicus


Alignment Length:306 Identity:76/306 - (24%)
Similarity:106/306 - (34%) Gaps:96/306 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 PTNTNNSG--RRTPRGYIYCRRRDSLDRSRSPQRSPVSRSPSPPNAGGNPAAAGNTAKSGDPSSG 148
            |::..:||  ...|:.::                ||    |..|:.||...||...|.:...|:.
  Rat    15 PSSVRHSGGLNLAPQNFV----------------SP----PQYPDYGGYHVAAAAAAAANLDSAQ 59

  Fly   149 TGNPPTLIRPLPLPAP-----NLALIGNRTSPNAMAVRMAGPPHPPSQPPPFLAAQFQMAAAL-A 207
            :..|..   |....||     |....|...:.||:|       |..:...|..|..:...|.. |
  Rat    60 SPGPSW---PTAYGAPLREDWNGYAPGGAAAANAVA-------HGLNGGSPAAAMGYSSPAEYHA 114

  Fly   208 HHHQQQQQQQQQQLPPVPTGPPHGPHPHLPPG--QIPLGIF----PGGPHPGHPPPHGH-HPFGS 265
            |||                  || .|||.|..  ....|:.    ||.|.|........ .|.|.
  Rat   115 HHH------------------PH-HHPHHPAAAPSCASGLLQTLNPGPPGPAATAAAEQLSPSGQ 160

  Fly   266 APHLIRDSYPLYPWLLSRHGRIFPRFPGNFLFQP-------FRKPKRVRTAFSPTQLLKLEHAFE 323
            ..:|..       |:         |.|.    ||       .|...:.|..::..|.|:||..|.
  Rat   161 RRNLCE-------WM---------RKPA----QPSLGSQVKTRTKDKYRVVYTDHQRLELEKEFH 205

  Fly   324 GNHYVVGAERKQLAQGLSLTETQVKVWFQNRRTKH-----KRMQQE 364
            .:.|:....:.:||..|.|:|.|||:||||||.|.     |::||:
  Rat   206 YSRYITIRRKAELAATLGLSERQVKIWFQNRRAKERKINKKKLQQQ 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E5NP_524825.1 Homeobox 307..359 CDD:278475 22/56 (39%)
Cdx2NP_076453.1 Caudal_act 13..170 CDD:282574 46/219 (21%)
Homeobox 189..241 CDD:278475 22/51 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0850
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.