DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E5 and Vax2

DIOPT Version :9

Sequence 1:NP_524825.1 Gene:E5 / 45396 FlyBaseID:FBgn0008646 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_072159.1 Gene:Vax2 / 64572 RGDID:621133 Length:292 Species:Rattus norvegicus


Alignment Length:137 Identity:51/137 - (37%)
Similarity:65/137 - (47%) Gaps:22/137 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   247 PGGPHPGHPPPHGHHPFGSAPH----LIRDSYPLYPWLLSRHGRIFPRFPGNFLFQPFRKPKRVR 307
            |.|.........|....|...|    |:||:......::...|....|            |||.|
  Rat    54 PAGSRESGGDSDGQQALGETDHCRRILVRDAKGTIREIVLPKGLDLDR------------PKRTR 106

  Fly   308 TAFSPTQLLKLEHAFEGNHYVVGAERKQLAQGLSLTETQVKVWFQNRRTKHKRMQQEGGDGSDTK 372
            |:|:..||.:||..|:...||||.||.:||:.|:|:||||||||||||||.|:      |.|...
  Rat   107 TSFTAEQLYRLEMEFQRCQYVVGRERTELARQLNLSETQVKVWFQNRRTKQKK------DQSRDL 165

  Fly   373 SNKGSSS 379
            ..:.|||
  Rat   166 EKRASSS 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E5NP_524825.1 Homeobox 307..359 CDD:278475 32/51 (63%)
Vax2NP_072159.1 vax upstream domain 74..101 5/26 (19%)
homeobox 102..161 36/64 (56%)
Homeobox 105..158 CDD:278475 32/52 (62%)
vax downstream domain 182..193
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 212..241
vax terminal domain 266..274
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166351394
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0850
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.