DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E5 and Vax1

DIOPT Version :10

Sequence 1:NP_524825.1 Gene:E5 / 45396 FlyBaseID:FBgn0008646 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_072158.1 Gene:Vax1 / 64571 RGDID:621132 Length:336 Species:Rattus norvegicus


Alignment Length:72 Identity:40/72 - (55%)
Similarity:52/72 - (72%) Gaps:3/72 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   302 KPKRVRTAFSPTQLLKLEHAFEGNHYVVGAERKQLAQGLSLTETQVKVWFQNRRTKHKRMQQEGG 366
            :|||.||:|:..||.:||..|:...||||.||.:||:.|:|:||||||||||||||.|:.|   |
  Rat    99 RPKRTRTSFTAEQLYRLEMEFQRCQYVVGRERTELARQLNLSETQVKVWFQNRRTKQKKDQ---G 160

  Fly   367 DGSDTKS 373
            ..|:.:|
  Rat   161 KDSELRS 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E5NP_524825.1 Homeodomain 304..360 CDD:459649 34/55 (62%)
Vax1NP_072158.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..39
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 50..69
vax upstream domain 72..99 40/72 (56%)
homeobox 100..159 36/58 (62%)
Homeodomain 101..157 CDD:459649 34/55 (62%)
vax downstream domain 178..189
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 236..267
vax terminal domain 315..323
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.