DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E5 and hoxc1a

DIOPT Version :10

Sequence 1:NP_524825.1 Gene:E5 / 45396 FlyBaseID:FBgn0008646 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_571606.1 Gene:hoxc1a / 58046 ZFINID:ZDB-GENE-000822-2 Length:302 Species:Danio rerio


Alignment Length:82 Identity:36/82 - (43%)
Similarity:47/82 - (57%) Gaps:9/82 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   307 RTAFSPTQLLKLEHAFEGNHYVVGAERKQLAQGLSLTETQVKVWFQNRRTKHKRMQQEG------ 365
            ||.|:..||.:||..|..|.|:..|.|.::|..|.|:|||||:||||||.|.|:|.:||      
Zfish   219 RTNFTTKQLTELEKEFHFNKYLTRARRIEIANPLQLSETQVKIWFQNRRMKQKKMLREGLAQGLM 283

  Fly   366 ---GDGSDTKSNKGSSS 379
               |...|:|.:...||
Zfish   284 LISGCDEDSKKSDTCSS 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E5NP_524825.1 Homeodomain 304..360 CDD:459649 27/52 (52%)
hoxc1aNP_571606.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 198..224 3/4 (75%)
Homeodomain 218..272 CDD:459649 27/52 (52%)

Return to query results.
Submit another query.