DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E5 and Noto

DIOPT Version :9

Sequence 1:NP_524825.1 Gene:E5 / 45396 FlyBaseID:FBgn0008646 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_001178943.1 Gene:Noto / 502857 RGDID:1562910 Length:245 Species:Rattus norvegicus


Alignment Length:282 Identity:77/282 - (27%)
Similarity:99/282 - (35%) Gaps:75/282 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   123 SPSPPNAGGNPAAAGNTAKSGDPSSGTGNPPTLIRPLPLPAPNLALIGNRTSPNAMAVRMAGP-- 185
            ||.|     .||::|...:.||    .|..|..:.|:   .||....|...|..::...:|.|  
  Rat     3 SPVP-----QPASSGTQVQPGD----LGPCPVAVSPV---VPNHLARGRLESSFSVEAILARPET 55

  Fly   186 -PHPPSQPPPFLAAQFQMAAALAHHHQQQQQQQQQQLPPV-PTGPPHGPHPHLPPGQIPLGIFPG 248
             .|..:..|..........:.          .|.|.||.| .||.       ..|..:.:||:| 
  Rat    56 REHSATSLPLSTCTSLNFGSV----------SQYQVLPWVCSTGT-------WLPTYLSVGIYP- 102

  Fly   249 GPHPGHPPPHGHHPFGSAPHLIRDSYPLYPWLLSRH----------GRIFPRFPGNFLFQPF--- 300
                                  ..|....|.|...|          |...|...|.....|.   
  Rat   103 ----------------------MCSMSCMPGLNVTHLFCQQGLRLTGSELPSCLGPLKRAPTVNL 145

  Fly   301 ------RKPKRVRTAFSPTQLLKLEHAFEGNHYVVGAERKQLAQGLSLTETQVKVWFQNRRTKHK 359
                  |..|||||.||..||.:||..|...|.:||.||.|||..|.|||.||::||||||.|::
  Rat   146 QDHNTERHQKRVRTMFSEQQLGELEKVFAKQHNLVGKERAQLAARLHLTENQVRIWFQNRRVKYQ 210

  Fly   360 RMQQEGGDGSDTKSNKGSSSGG 381
            :.|:......|......:||.|
  Rat   211 KQQKLKSPPPDAMEEPSNSSEG 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E5NP_524825.1 Homeobox 307..359 CDD:278475 30/51 (59%)
NotoNP_001178943.1 Homeobox 158..209 CDD:278475 29/50 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0850
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24339
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.