DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E5 and Emx1

DIOPT Version :9

Sequence 1:NP_524825.1 Gene:E5 / 45396 FlyBaseID:FBgn0008646 Length:524 Species:Drosophila melanogaster
Sequence 2:XP_575584.5 Gene:Emx1 / 500235 RGDID:1564002 Length:290 Species:Rattus norvegicus


Alignment Length:337 Identity:119/337 - (35%)
Similarity:142/337 - (42%) Gaps:102/337 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 TRSAPLRVSVISSPPPRSESPAS----PTNTNNSGRRTPRGYIYCRRRDSLDRSRSPQRSPVSRS 123
            |.:||...:...:|.|.|.|.|:    |.        |.||:..        .|...:......|
  Rat    10 TAAAPGHRAFPRAPLPHSSSAAATMFQPA--------TKRGFTI--------ESLVAKDGGTGGS 58

  Fly   124 PSPPNAGGNPAAAGNTAKSGDPSSGTGNPPTLIRPLPLPAPNLALIGNRTSPNAMAVRMAGPPHP 188
            |....||.:|.|   .|.|.:|          :||..|                      ..|||
  Rat    59 PGSGGAGSHPLA---VAASEEP----------LRPTAL----------------------NYPHP 88

  Fly   189 PSQPPPFLAAQFQMAAALAHHHQQQQQQQQQQLPPVPTGPPHGPHPHLPPGQIPLGIFPGGPHPG 253
            .:....|::. |..|||..       ..:.....|....|....||.|.            .||.
  Rat    89 SAAETAFVSG-FPAAAAAG-------ASRSLYGGPELVFPEAMNHPALT------------VHPA 133

  Fly   254 H-------PPPHGHHPFGSAPHLIRDSYPLYPWLLSRHGRIF-PRF-------PGNFLFQPF-RK 302
            |       .|||.   |.||.|  ||....|||:|  ..|.| .||       .|..|..|| ||
  Rat   134 HQLGSSSLQPPHS---FFSAQH--RDPLHFYPWVL--RNRFFGHRFQASEVPQDGLLLHGPFARK 191

  Fly   303 PKRVRTAFSPTQLLKLEHAFEGNHYVVGAERKQLAQGLSLTETQVKVWFQNRRTKHKR--MQQEG 365
            |||:||||||:|||:||.|||.|||||||||||||..|||:||||||||||||||:||  :::||
  Rat   192 PKRIRTAFSPSQLLRLERAFEKNHYVVGAERKQLAGSLSLSETQVKVWFQNRRTKYKRQKLEEEG 256

  Fly   366 GDGSDTKSNKGS 377
            .:....|  |||
  Rat   257 PESEQKK--KGS 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E5NP_524825.1 Homeobox 307..359 CDD:278475 44/51 (86%)
Emx1XP_575584.5 COG5576 141..>251 CDD:227863 72/116 (62%)
Homeobox 196..248 CDD:278475 44/51 (86%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 104 1.000 Domainoid score I6568
eggNOG 1 0.900 - - E1_KOG0850
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000921
OrthoInspector 1 1.000 - - mtm9028
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR24339
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X14
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
98.870

Return to query results.
Submit another query.