DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E5 and Emx2

DIOPT Version :9

Sequence 1:NP_524825.1 Gene:E5 / 45396 FlyBaseID:FBgn0008646 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_001102639.1 Gene:Emx2 / 499380 RGDID:1564797 Length:253 Species:Rattus norvegicus


Alignment Length:340 Identity:121/340 - (35%)
Similarity:144/340 - (42%) Gaps:126/340 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 PKLAFSIDSIVGESSTRSAPLRVSVISSPPPRSESPASPTNTNNSGRRTPRGYIYCRRRDSLDRS 112
            ||..|:|:|:|.:.|    ||       |..|||.|..|.                    :|..:
  Rat     6 PKRCFTIESLVAKDS----PL-------PASRSEDPIRPA--------------------ALSYA 39

  Fly   113 RSPQRSPVSRSPSPPNAGGNPAAAGNTAKSGDPSSGTGNPPTLIRPLPLPAPNLALIGNRTSPNA 177
            .|   ||:    :|...|.:.|||...|..|..|    ||..:........||.|:         
  Rat    40 NS---SPI----NPFLNGFHSAAAAAAAGRGVYS----NPDLVFAEAVSHPPNPAV--------- 84

  Fly   178 MAVRMAGPPHPPSQPPPFLAAQFQMAAALAHHHQQQQQQQQQQLPPVPTGPPHGPHPHLPPGQIP 242
                   |.||  .|||.         |||.|             |:|:.  |.|||.....|  
  Rat    85 -------PVHP--VPPPH---------ALAAH-------------PLPSS--HSPHPLFASQQ-- 114

  Fly   243 LGIFPGGPHPGHPPPHGHHPFGSAPHLIRDSYPLYPWLLSRHGRIFPRFPGN------FLFQP-- 299
                                        ||....||||:.|:..:..||.||      ||...  
  Rat   115 ----------------------------RDPSTFYPWLIHRYRYLGHRFQGNDTSPESFLLHNAL 151

  Fly   300 FRKPKRVRTAFSPTQLLKLEHAFEGNHYVVGAERKQLAQGLSLTETQVKVWFQNRRTKHKR--MQ 362
            .|||||:||||||:|||:||||||.|||||||||||||..||||||||||||||||||.||  ::
  Rat   152 ARKPKRIRTAFSPSQLLRLEHAFEKNHYVVGAERKQLAHSLSLTETQVKVWFQNRRTKFKRQKLE 216

  Fly   363 QEGGDGSDTKSNKGS 377
            :||.|....|  ||:
  Rat   217 EEGSDSQQKK--KGT 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E5NP_524825.1 Homeobox 307..359 CDD:278475 46/51 (90%)
Emx2NP_001102639.1 Homeobox 159..212 CDD:395001 46/52 (88%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 104 1.000 Domainoid score I6568
eggNOG 1 0.900 - - E1_KOG0850
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000921
OrthoInspector 1 1.000 - - mtm9028
orthoMCL 1 0.900 - - OOG6_109182
Panther 1 1.100 - - O PTHR24339
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X14
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
109.770

Return to query results.
Submit another query.