DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E5 and emx1

DIOPT Version :9

Sequence 1:NP_524825.1 Gene:E5 / 45396 FlyBaseID:FBgn0008646 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_001005459.1 Gene:emx1 / 448058 XenbaseID:XB-GENE-920144 Length:233 Species:Xenopus tropicalis


Alignment Length:209 Identity:95/209 - (45%)
Similarity:116/209 - (55%) Gaps:38/209 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   180 VRMAGPPHPPSQPPPFLAAQFQMAAALAHHHQQQQQQQQQQLPPVPTGPPHGPHPHLPPGQIPLG 244
            :|.|..|:|.:....|::. |...|..:.::     ..:...|...:.||...|||    |:   
 Frog    28 LRPAALPYPGAPAEAFVSG-FPSPAGRSLYN-----NPELVFPETVSHPPLTVHPH----QL--- 79

  Fly   245 IFPGGPHPGHPPPHGHHPFGSAPHLIRDSYPLYPWLLSRHGRIF-PRFPGN-------FLFQPF- 300
               |..|..||     |.|.:..|  ||....|||:|  ..|.| .||.|.       .|..|| 
 Frog    80 ---GASHLQHP-----HSFFAPQH--RDPLNFYPWVL--RNRFFGHRFQGGDVSQESLLLHGPFA 132

  Fly   301 RKPKRVRTAFSPTQLLKLEHAFEGNHYVVGAERKQLAQGLSLTETQVKVWFQNRRTKHKR--MQQ 363
            |||||:||||||:|||:||.|||.|||||||||||||..|||:||||||||||||||:||  :::
 Frog   133 RKPKRIRTAFSPSQLLRLERAFEKNHYVVGAERKQLASSLSLSETQVKVWFQNRRTKYKRQKLEE 197

  Fly   364 EGGDGSDTKSNKGS 377
            ||.| ||.| .|||
 Frog   198 EGPD-SDQK-KKGS 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E5NP_524825.1 Homeobox 307..359 CDD:278475 44/51 (86%)
emx1NP_001005459.1 COG5576 85..>194 CDD:227863 70/117 (60%)
Homeobox 139..192 CDD:365835 44/52 (85%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 192..233 10/20 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 104 1.000 Domainoid score I6622
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000921
OrthoInspector 1 1.000 - - mtm9445
Panther 1 1.100 - - LDO PTHR24339
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3162
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.040

Return to query results.
Submit another query.