DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E5 and dlx5

DIOPT Version :9

Sequence 1:NP_524825.1 Gene:E5 / 45396 FlyBaseID:FBgn0008646 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_001004778.1 Gene:dlx5 / 447997 XenbaseID:XB-GENE-853057 Length:289 Species:Xenopus tropicalis


Alignment Length:339 Identity:74/339 - (21%)
Similarity:113/339 - (33%) Gaps:124/339 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   197 AAQFQMAAALAHHHQQQQQQQQQQLPPVP---------------TGPPHGPHPHLPPGQIPLG-- 244
            |.:||   ::.||..|..       |.:|               .|.||  |.:..|.....|  
 Frog    14 ATEFQ---SIMHHPSQDS-------PTLPESTATDSGYYSPGGAAGHPH--HGYCSPTSATYGKA 66

  Fly   245 ------IFPG-----GPHPGH--------PPPHGHHPFGSAPHLIRDSYPLYPWLLSRHGRIFPR 290
                  .:.|     |.:||.        .|.|.||.:..|                 :.|:.| 
 Frog    67 LNAYQYQYHGMNGAAGNYPGKAYSDYGYGSPYHPHHQYSGA-----------------YNRVQP- 113

  Fly   291 FPGNFLFQPFR------------KPKRV---RTAFSPTQLLKLEHAFEGNHYVVGAERKQLAQGL 340
             |.:   ||.:            |||::   ||.:|..||..|:..|:...|:...||.:||..|
 Frog   114 -PSS---QPEKEVSEPEVRMVNGKPKKIRKPRTIYSSFQLAALQRRFQKTQYLALPERAELAASL 174

  Fly   341 SLTETQVKVWFQNRRTKHKRMQQEGGDGSDTKSNKGSSSGGGGGGDGEDDAKHDGSQHSYEDAED 405
            .||:||||:||||:|:|.|::.:                      :||...:|           .
 Frog   175 GLTQTQVKIWFQNKRSKIKKIMK----------------------NGELPPEH-----------S 206

  Fly   406 PEDEDEIEEDDEDEVIDMDDYGSEMDAEEHQRLREQFQQQLAQHQQQFMQQNAGEAATLSPQQQH 470
            |...|.:..:.....:..:..||......|..:....|...:.....:::    .::...|...|
 Frog   207 PSSSDPMACNSPQSPVVWEPQGSSRSLSHHPHVHSHPQASGSSPASSYLE----NSSVWYPTGTH 267

  Fly   471 QLLQQHQQHLQQQH 484
              ||..|.|...||
 Frog   268 --LQNLQNHASLQH 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E5NP_524825.1 Homeobox 307..359 CDD:278475 25/51 (49%)
dlx5NP_001004778.1 DLL_N 26..118 CDD:315147 21/122 (17%)
Homeobox 140..193 CDD:306543 25/52 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.