DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E5 and cdx4

DIOPT Version :9

Sequence 1:NP_524825.1 Gene:E5 / 45396 FlyBaseID:FBgn0008646 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_989417.1 Gene:cdx4 / 395056 XenbaseID:XB-GENE-482787 Length:260 Species:Xenopus tropicalis


Alignment Length:241 Identity:61/241 - (25%)
Similarity:87/241 - (36%) Gaps:66/241 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   178 MAVRMAGPPHP----PSQPPPFLAAQFQMAAALAHHHQQQQQQQQQQLPPVPTGPPHG-PHPH-- 235
            ::||.|...|.    .|..|.|        ..:.:||.....:|.|  |....||.:| |...  
 Frog    19 LSVRSASNNHSAQNYASNQPYF--------NYVTYHHVPPMDEQGQ--PCGVWGPQYGSPREQWN 73

  Fly   236 ----------------LPPGQIPLGIFP-GGPHPG-----HPPPHGHHPFGSAPHLIRDSYPLYP 278
                            |.|.|....... ..|||.     |.....|....|...|.::|   |.
 Frog    74 SYGAGPSNTNMAQSSDLSPNQFAYNSSGYSSPHPSGTGILHSVDLSHTAANSPSDLSQNS---YE 135

  Fly   279 WL-----LSRHGRIFPRFPGNFLFQPFRKPKRVRTAFSPTQLLKLEHAFEGNHYVVGAERKQLAQ 338
            |:     .:..|:.             |..::.|..::..|.|:||..|..:.|:....:.:||.
 Frog   136 WMGKTVQSTSTGKT-------------RTKEKYRVVYTDHQRLELEKEFHYSRYITIRRKTELAA 187

  Fly   339 GLSLTETQVKVWFQNRRTKH-----KRMQQEGGDGSDTKSNKGSSS 379
            .|.|:|.|||:||||||.|.     |:|.|..|..| .:|:..|:|
 Frog   188 SLRLSERQVKIWFQNRRAKERKLFKKKMNQFDGICS-VQSDSSSAS 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E5NP_524825.1 Homeobox 307..359 CDD:278475 22/56 (39%)
cdx4NP_989417.1 Caudal_act 16..139 CDD:282574 29/132 (22%)
Homeobox 156..208 CDD:278475 22/51 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.