DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E5 and cdx2

DIOPT Version :9

Sequence 1:NP_524825.1 Gene:E5 / 45396 FlyBaseID:FBgn0008646 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_989209.1 Gene:cdx2 / 394817 XenbaseID:XB-GENE-483306 Length:252 Species:Xenopus tropicalis


Alignment Length:312 Identity:75/312 - (24%)
Similarity:101/312 - (32%) Gaps:122/312 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 YCRRRDSLDRSRSPQRSP-VSRSPSPPNAGGNPAAAGNTAKSGDPSSGTGNPPTLIRPLPLPAPN 165
            |...:|:.....|.:..| :...|:.|......:..|.....|.||||:                
 Frog     5 YLLEKDAAMYPGSMRAHPGLQNYPAAPQYPDYGSYHGMGLDHGAPSSGS---------------- 53

  Fly   166 LALIGNRTSPNAMAVRMAGPP------HPPSQPPPFLAAQFQMAAALAHHHQQQQQQQQQQLPPV 224
                      :|..:...|||      ||...|              .|.|          :.|.
 Frog    54 ----------SAGWITPYGPPRDEWGVHPTYSP--------------GHTH----------INPS 84

  Fly   225 PTG-----PPHGPHPHLPPGQIPLGIFPGGP----HPGHPPPHGHHPFGSAPHLIRDSYPLYPWL 280
            |.|     |.:.|..  ..||..:|:.|.||    .||....|..|      |        |.||
 Frog    85 PVGNMAFSPDYSPAQ--VQGQPCVGVLPAGPPPQLSPGSEDGHRRH------H--------YEWL 133

  Fly   281 LSRHGRIFPRFPGNFLFQPFRKP-------------KRVRTAFSPTQLLKLEHAFEGNHYVVGAE 332
                                |||             .:.|..::..|.|:||..|..:.|:....
 Frog   134 --------------------RKPVSQASTGSKTRTKDKYRVVYTDQQRLELEKEFHYSRYITIRR 178

  Fly   333 RKQLAQGLSLTETQVKVWFQNRRTKH-----KRMQ--QEGGDGSDTKSNKGS 377
            :.:||..|.|:|.|||:||||||.|.     ||:|  |.|.:|.||.|.:.|
 Frog   179 KAELAANLGLSERQVKIWFQNRRAKERKITKKRIQQTQTGQNGPDTLSPEPS 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E5NP_524825.1 Homeobox 307..359 CDD:278475 22/56 (39%)
cdx2NP_989209.1 Caudal_act 13..135 CDD:368087 38/207 (18%)
Homeobox 153..206 CDD:365835 22/52 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.