DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E5 and ventx1.2

DIOPT Version :10

Sequence 1:NP_524825.1 Gene:E5 / 45396 FlyBaseID:FBgn0008646 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_988861.1 Gene:ventx1.2 / 394455 XenbaseID:XB-GENE-920868 Length:262 Species:Xenopus tropicalis


Alignment Length:61 Identity:33/61 - (54%)
Similarity:43/61 - (70%) Gaps:0/61 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   304 KRVRTAFSPTQLLKLEHAFEGNHYVVGAERKQLAQGLSLTETQVKVWFQNRRTKHKRMQQE 364
            :|:||||:|.|:.:||.||....|:..:|||:||..|.|:|.|||.||||||.|.||..|:
 Frog   128 RRLRTAFTPQQITRLEQAFNKQRYLGASERKKLATSLQLSEIQVKTWFQNRRMKLKRQIQD 188

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
E5NP_524825.1 Homeodomain 304..360 CDD:459649 30/55 (55%)