DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E5 and CG34031

DIOPT Version :10

Sequence 1:NP_524825.1 Gene:E5 / 45396 FlyBaseID:FBgn0008646 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_001246894.1 Gene:CG34031 / 3885665 FlyBaseID:FBgn0054031 Length:219 Species:Drosophila melanogaster


Alignment Length:60 Identity:31/60 - (51%)
Similarity:43/60 - (71%) Gaps:3/60 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   301 RKPKRVRTAFSPTQLLKLEHAFEGNHYVVGAERKQLAQGLSLTETQVKVWFQNRRTKHKR 360
            |||   |.|:|.:||.:||:.|..:.|:..::|.:|::.|||||.|||.||||||||.|:
  Fly   134 RKP---RQAYSASQLERLENEFNLDKYLSVSKRVELSKSLSLTEVQVKTWFQNRRTKWKK 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E5NP_524825.1 Homeodomain 304..360 CDD:459649 27/55 (49%)
CG34031NP_001246894.1 Homeodomain 134..190 CDD:459649 30/58 (52%)

Return to query results.
Submit another query.