DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E5 and Dll

DIOPT Version :9

Sequence 1:NP_524825.1 Gene:E5 / 45396 FlyBaseID:FBgn0008646 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_001137759.1 Gene:Dll / 37973 FlyBaseID:FBgn0000157 Length:347 Species:Drosophila melanogaster


Alignment Length:188 Identity:63/188 - (33%)
Similarity:85/188 - (45%) Gaps:40/188 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   227 GPPHGPHPHLPPGQIPLGIFPGGPHPGHPPPH-----GHH------PFGSAPHLIRDSYPLYPWL 280
            ||..|.....|..:..|| :|      .||.|     |:|      |..|.|   :|.:.:....
  Fly    56 GPQGGQDSGFPSPRSALG-YP------FPPMHQNSYSGYHLGSYAPPCASPP---KDDFSISDKC 110

  Fly   281 LSRHGRIFPRFPGNFLFQPFRKPKRVRTAFSPTQLLKLEHAFEGNHYVVGAERKQLAQGLSLTET 345
            .....|:      |...:..|||   ||.:|..||.:|...|:...|:...||.:||..|.||:|
  Fly   111 EDSGLRV------NGKGKKMRKP---RTIYSSLQLQQLNRRFQRTQYLALPERAELAASLGLTQT 166

  Fly   346 QVKVWFQNRRTKHKRMQQEG-GDGSDTKSNKGSSSGGGGGGDGEDDAKHDGSQ-HSYE 401
            |||:||||||:|:|:|.:.. |.|    :|.|...||||...|:    |..:| ||.|
  Fly   167 QVKIWFQNRRSKYKKMMKAAQGPG----TNSGMPLGGGGPNPGQ----HSPNQMHSGE 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E5NP_524825.1 Homeobox 307..359 CDD:278475 26/51 (51%)
DllNP_001137759.1 Homeobox 127..180 CDD:278475 27/55 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 1 0.900 - - E1_KOG0850
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.