DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E5 and emx1

DIOPT Version :9

Sequence 1:NP_524825.1 Gene:E5 / 45396 FlyBaseID:FBgn0008646 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_937787.1 Gene:emx1 / 378964 ZFINID:ZDB-GENE-031007-7 Length:231 Species:Danio rerio


Alignment Length:174 Identity:83/174 - (47%)
Similarity:95/174 - (54%) Gaps:36/174 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   225 PTGPPHGPHPHL----PPGQIPLGIFPGGPHPGHPPPHGHHPFGSA----PHLI----RDSYPLY 277
            |.|....|:|.|    .....||.:.|             |..|||    ||..    |:....|
Zfish    49 PAGRALYPNPELVFSETVNHAPLSMHP-------------HQLGSAPLQHPHFFGTQHREPLNFY 100

  Fly   278 PWLLSRHGRIF-PRFPGN-------FLFQPF-RKPKRVRTAFSPTQLLKLEHAFEGNHYVVGAER 333
            ||:|  ..|.| .||.||       .|..|| |||||:||||||:|||:||.|||.|||||||||
Zfish   101 PWVL--RNRFFGHRFQGNDVSQDTLLLHGPFARKPKRIRTAFSPSQLLRLERAFEKNHYVVGAER 163

  Fly   334 KQLAQGLSLTETQVKVWFQNRRTKHKRMQQEGGDGSDTKSNKGS 377
            ||||..|||:||||||||||||||:||.:.|......|:..||:
Zfish   164 KQLANSLSLSETQVKVWFQNRRTKYKRQKLEEEGPECTQKKKGN 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E5NP_524825.1 Homeobox 307..359 CDD:278475 44/51 (86%)
emx1NP_937787.1 COG5576 82..>192 CDD:227863 67/111 (60%)
Homeobox 137..189 CDD:278475 44/51 (86%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 193..231 4/15 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 105 1.000 Domainoid score I6584
eggNOG 1 0.900 - - E1_KOG0850
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000921
OrthoInspector 1 1.000 - - mtm6489
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR24339
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3162
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
98.900

Return to query results.
Submit another query.