powered by:
Protein Alignment E5 and lms
DIOPT Version :9
Sequence 1: | NP_524825.1 |
Gene: | E5 / 45396 |
FlyBaseID: | FBgn0008646 |
Length: | 524 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001286635.1 |
Gene: | lms / 37322 |
FlyBaseID: | FBgn0034520 |
Length: | 378 |
Species: | Drosophila melanogaster |
Alignment Length: | 59 |
Identity: | 34/59 - (57%) |
Similarity: | 41/59 - (69%) |
Gaps: | 0/59 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 302 KPKRVRTAFSPTQLLKLEHAFEGNHYVVGAERKQLAQGLSLTETQVKVWFQNRRTKHKR 360
:.||.|||||..|:..||..||...|:..|:|..||:.|.|||||:|:||||||||.||
Fly 85 RKKRPRTAFSAAQIKALETEFERGKYLSVAKRTALAKQLQLTETQIKIWFQNRRTKWKR 143
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C45466608 |
Domainoid |
1 |
1.000 |
53 |
1.000 |
Domainoid score |
I4196 |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D858478at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
P |
PTHR24339 |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
1 |
1.000 |
- |
- |
|
X14 |
|
6 | 5.950 |
|
Return to query results.
Submit another query.