DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E5 and NOTO

DIOPT Version :9

Sequence 1:NP_524825.1 Gene:E5 / 45396 FlyBaseID:FBgn0008646 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_001127934.1 Gene:NOTO / 344022 HGNCID:31839 Length:251 Species:Homo sapiens


Alignment Length:293 Identity:86/293 - (29%)
Similarity:111/293 - (37%) Gaps:83/293 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 SPPPRSESPASPTNTNNSGRRTPRGYIYCRRRDSLDRSRSPQ--RSPVSRSPSPPNAGGNPAAAG 137
            ||.||...|.:|:.:                     |.|.|:  |||..|||:.||   .|.|.|
Human     3 SPRPRGSPPPAPSGS---------------------RVRPPRSGRSPAPRSPTGPN---TPRAPG 43

  Fly   138 NTAKSGDPSSGTGNPPTLIRPLP-LPAPNLALIGNRTSPNAMAVRMAGPPHPPSQPPPFLAAQFQ 201
               :...|.|...   .|.||.| .||        .:.|:..|.     .||          .|.
Human    44 ---RFESPFSVEA---ILARPDPCAPA--------ASQPSGSAC-----VHP----------AFW 79

  Fly   202 MAAALAHHHQQQQQQQQQQLPPVPTGPPHGPHPHLPPGQIPLGIFPGGPHPGHPPPHGHHPFGSA 266
            .||:|.                ...|.|........|..:.:|.:| .|.|...|..|...||..
Human    80 TAASLC----------------ATGGLPWACPTSWLPAYLSVGFYP-VPGPRVAPVCGLLGFGVT 127

  Fly   267 PHLIRDSYPLYPWLLSRHGRIFPRF-PGNFLFQPFRKPKRVRTAFSPTQLLKLEHAFEGNHYVVG 330
            ...:.....|:         .||.: |...|....|:.|||||.|:..||.:||..|...|.:||
Human   128 GLELAHCSGLW---------AFPDWAPTEDLQDTERQQKRVRTMFNLEQLEELEKVFAKQHNLVG 183

  Fly   331 AERKQLAQGLSLTETQVKVWFQNRRTKHKRMQQ 363
            .:|.|||..|.|||.||:|||||||.|:::.|:
Human   184 KKRAQLAARLKLTENQVRVWFQNRRVKYQKQQK 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E5NP_524825.1 Homeobox 307..359 CDD:278475 29/51 (57%)
NOTONP_001127934.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..47 20/70 (29%)
Homeobox 160..211 CDD:278475 28/50 (56%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 224..251
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0850
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24339
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.