DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E5 and HOXA13

DIOPT Version :9

Sequence 1:NP_524825.1 Gene:E5 / 45396 FlyBaseID:FBgn0008646 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_000513.2 Gene:HOXA13 / 3209 HGNCID:5102 Length:388 Species:Homo sapiens


Alignment Length:399 Identity:91/399 - (22%)
Similarity:152/399 - (38%) Gaps:122/399 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 AASSTSVSASSTVSASASSKPKLA-------FSIDSIVGESSTRSAPLRVSVISSPPPRSESPAS 85
            ||::.:.:|::...|.....|..|       ||:.:....::..:|....::::.|.|.:...||
Human    39 AAAAAAAAAAAAAGAGGGGFPHPAAAAAGGNFSVAAAAAAAAAAAANQCRNLMAHPAPLAPGAAS 103

  Fly    86 PTNTNNSGRRTPRGYIYCRRRDSLDRSRSPQRSPVSRSPSPPNAGGNPAAAGNTAKSGDPSSGTG 150
                         .|           |.:|       ..:||:|....|||...|.:...:|.:|
Human   104 -------------AY-----------SSAP-------GEAPPSAAAAAAAAAAAAAAAAAASSSG 137

  Fly   151 NPPTLIRPLPLPA-PNLALIGNRTSP-NAMAVRMAGP-------------------PHPP----- 189
            .|.        || |..|....:.|| :|.|...:||                   |||.     
Human   138 GPG--------PAGPAGAEAAKQCSPCSAAAQSSSGPAALPYGYFGSGYYPCARMGPHPNAIKSC 194

  Fly   190 SQPPPFLAAQFQMAAALAHHHQ-------QQQQQQQQQLPPVPTGPPHGP-HPHLP-PGQIPLGI 245
            :||     |....|||.|..:.       ::...:.::......|...|| |.|.| ||.:.:.:
Human   195 AQP-----ASAAAAAAFADKYMDTAGPAAEEFSSRAKEFAFYHQGYAAGPYHHHQPMPGYLDMPV 254

  Fly   246 FPGGPHPGHPPPHGHHPFGSAPHLIRDSYPLYPWLLSR--HGRIF-PRFPGNFLFQP-------- 299
            .||   .|.|....|.|.|    |..:||  .||.|..  :|::: |:...    ||        
Human   255 VPG---LGGPGESRHEPLG----LPMESY--QPWALPNGWNGQMYCPKEQA----QPPHLWKSTL 306

  Fly   300 ------------FRKPKRVRTAFSPTQLLKLEHAFEGNHYVVGAERKQLAQGLSLTETQVKVWFQ 352
                        :|:.::.|..::..||.:||..:..|.::...:|::::...:|:|.||.:|||
Human   307 PDVVSHPSDASSYRRGRKKRVPYTKVQLKELEREYATNKFITKDKRRRISATTNLSERQVTIWFQ 371

  Fly   353 NRRTKHKRM 361
            |||.|.|::
Human   372 NRRVKEKKV 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E5NP_524825.1 Homeobox 307..359 CDD:278475 18/51 (35%)
HOXA13NP_000513.2 HoxA13_N 85..222 CDD:403486 37/180 (21%)
Homeobox 325..379 CDD:395001 18/53 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.