DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E5 and dlx6a

DIOPT Version :9

Sequence 1:NP_524825.1 Gene:E5 / 45396 FlyBaseID:FBgn0008646 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_571398.1 Gene:dlx6a / 30586 ZFINID:ZDB-GENE-980526-448 Length:247 Species:Danio rerio


Alignment Length:217 Identity:65/217 - (29%)
Similarity:88/217 - (40%) Gaps:63/217 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   196 LAAQFQMAAALAHHHQQQQQQQQQQLPPVPTGPPHGPHPHLPPGQIPLGIFPGGPHPGHPPPHGH 260
            |.||....:|.....||...||..              |.:.....||       |..|...|.|
Zfish    11 LEAQDSSKSAFMEFGQQSHSQQSS--------------PSMAASHYPL-------HCLHSGSHHH 54

  Fly   261 HPFGSAPHLIRDSY-----------PLY-PWLLSRH-----------------------GRIFPR 290
            |...|:|:...:||           |.: |:|.|.|                       |.|  |
Zfish    55 HQHDSSPYSGSNSYNRSLPYSYVSHPHHSPYLPSYHSNASGTQTRLDATEQQKTTVIENGEI--R 117

  Fly   291 FPGNFLFQPFRKPKRVRTAFSPTQLLKLEHAFEGNHYVVGAERKQLAQGLSLTETQVKVWFQNRR 355
            |.|.  .:..|||   ||.:|..||..|.|.|:...|:...||.:||..|.||:||||:||||:|
Zfish   118 FNGK--GKKIRKP---RTIYSSLQLQALNHRFQQTQYLALPERAELAASLGLTQTQVKIWFQNKR 177

  Fly   356 TKHKRMQQEGGDGSDTKSNKGS 377
            :|.|::.::||:..:|.:..||
Zfish   178 SKFKKLLKQGGNPHETDTLPGS 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E5NP_524825.1 Homeobox 307..359 CDD:278475 26/51 (51%)
dlx6aNP_571398.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 22..66 14/64 (22%)
Homeobox 128..181 CDD:278475 27/55 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0850
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.