DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E5 and dlx3b

DIOPT Version :9

Sequence 1:NP_524825.1 Gene:E5 / 45396 FlyBaseID:FBgn0008646 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_571397.2 Gene:dlx3b / 30585 ZFINID:ZDB-GENE-980526-280 Length:269 Species:Danio rerio


Alignment Length:187 Identity:54/187 - (28%)
Similarity:78/187 - (41%) Gaps:31/187 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   187 HPPSQPPPFL--AAQFQMAAALAHHHQQQQQQQQQQLPPVPTGPPHGPHPHLPPGQIPLGIFPGG 249
            ||.|:..|.|  ::...|....:||...|.....||:        :..|.....|.        |
Zfish    24 HPTSKDSPTLPESSATDMGYYSSHHEYYQSPPYPQQM--------NSYHQFNLSGM--------G 72

  Fly   250 PHPGHPPPHGHHPFGS---APHLIRDSYPLYPWLLSRHGRIFPRFPGNFLFQPFRKPKRV---RT 308
            ..||..|....:|:.:   ..|..||       |.:.........|...:.....|||::   ||
Zfish    73 ATPGAYPTKTEYPYNTYRQYGHYNRD-------LQTPPQSAVKEEPETEVRMVNGKPKKIRKPRT 130

  Fly   309 AFSPTQLLKLEHAFEGNHYVVGAERKQLAQGLSLTETQVKVWFQNRRTKHKRMQQEG 365
            .:|..||..|:..|:...|:...||.:||..|.||:||||:||||||:|.|::.:.|
Zfish   131 IYSSYQLAALQRRFQKAQYLALPERAELAAQLGLTQTQVKIWFQNRRSKFKKLYKNG 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E5NP_524825.1 Homeobox 307..359 CDD:278475 26/51 (51%)
dlx3bNP_571397.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..41 5/16 (31%)
DLL_N 28..104 CDD:289198 19/98 (19%)
Homeobox 128..181 CDD:278475 26/52 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 191..242
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 250..269
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0850
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.