DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E5 and dlx4b

DIOPT Version :9

Sequence 1:NP_524825.1 Gene:E5 / 45396 FlyBaseID:FBgn0008646 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_571393.1 Gene:dlx4b / 30581 ZFINID:ZDB-GENE-990415-50 Length:254 Species:Danio rerio


Alignment Length:197 Identity:62/197 - (31%)
Similarity:87/197 - (44%) Gaps:25/197 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   196 LAAQFQMAAALAHH----HQQQQQQQQQQLPPVPTGPPHGPHP--HLPPGQIPLGIFPGGPHPGH 254
            ||:..|..:..||:    |........|...|.|:..||...|  :..||.:.... ||...|..
Zfish    28 LASNQQHLSGFAHNIYPVHGLHSGGHLQHDAPYPSSAPHYSRPLGYAYPGPVSAAA-PGAYMPYQ 91

  Fly   255 PPPHGHHPFGSAPHL-IRDSYPLYPWLLSRHGRIFPRFPGNFLFQPFRKPKRVRTAFSPTQLLKL 318
            |..|.    |:..|. ..|:....|.:: .:|.|  |..|.  .:..|||   ||.:|..||..|
Zfish    92 PNNHS----GALAHTRAEDTNHEKPAVI-ENGEI--RLNGK--GKKIRKP---RTIYSSVQLQAL 144

  Fly   319 EHAFEGNHYVVGAERKQLAQGLSLTETQVKVWFQNRRTKHKRMQQEGGDGSD-----TKSNKGSS 378
            ...|:...|:...||..||..|.||:||||:||||:|:|:|::.:.|..|.:     |.|:...|
Zfish   145 HQRFQQTQYLALPERADLAAKLGLTQTQVKIWFQNKRSKYKKIMKHGSSGPEGELLHTSSSSPCS 209

  Fly   379 SG 380
            .|
Zfish   210 PG 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E5NP_524825.1 Homeobox 307..359 CDD:278475 25/51 (49%)
dlx4bNP_571393.1 Homeobox 132..185 CDD:278475 26/55 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0850
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.