powered by:
Protein Alignment E5 and dlx2a
DIOPT Version :9
Sequence 1: | NP_524825.1 |
Gene: | E5 / 45396 |
FlyBaseID: | FBgn0008646 |
Length: | 524 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_571386.2 |
Gene: | dlx2a / 30574 |
ZFINID: | ZDB-GENE-980526-212 |
Length: | 274 |
Species: | Danio rerio |
Alignment Length: | 67 |
Identity: | 32/67 - (47%) |
Similarity: | 44/67 - (65%) |
Gaps: | 3/67 - (4%) |
- Green bases have known domain annotations that are detailed below.
Fly 302 KPKRV---RTAFSPTQLLKLEHAFEGNHYVVGAERKQLAQGLSLTETQVKVWFQNRRTKHKRMQQ 363
|||:| ||.:|..||..|:..|:...|:...||.:||..|.||:||||:||||||:|.|::.:
Zfish 123 KPKKVRKPRTIYSSFQLAALQRRFQKTQYLALPERAELAASLGLTQTQVKIWFQNRRSKFKKLWK 187
Fly 364 EG 365
.|
Zfish 188 SG 189
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG0850 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.810 |
|
Return to query results.
Submit another query.