DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E5 and dlx5a

DIOPT Version :9

Sequence 1:NP_524825.1 Gene:E5 / 45396 FlyBaseID:FBgn0008646 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_571381.2 Gene:dlx5a / 30569 ZFINID:ZDB-GENE-990415-49 Length:282 Species:Danio rerio


Alignment Length:212 Identity:57/212 - (26%)
Similarity:84/212 - (39%) Gaps:57/212 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   189 PSQPPPFLAAQFQMAAALAHHHQQQQQQQQQQLPPVPTGPPHGPHPHLPPGQIPLGIFPGGPHPG 253
            ||..|......||::..   ||..|:.      |.:|.........:.|         .||.|.|
Zfish    10 PSIKPADFQNPFQLSTM---HHPSQES------PTLPESTATDSGYYSP---------AGGVHHG 56

  Fly   254 HPPPHG--------------HHPFGSAPHLIRDSYPLYPWLLSRHGRIFPRFPGNF---LFQPF- 300
            :..|:.              |...||:.:....|||.|    ..:...:.::.|.:   ..||. 
Zfish    57 YCSPNSGTYGKPLNAYQYQYHGVNGSSGNYSAKSYPDY----GSYSTAYHQYAGTYNRVQSQPSP 117

  Fly   301 --------------RKPKRV---RTAFSPTQLLKLEHAFEGNHYVVGAERKQLAQGLSLTETQVK 348
                          .|||:|   ||.:|..||..|:..|:...|:...||.:||..|.||:||||
Zfish   118 QEKETAEPEVRMVNGKPKKVRKPRTIYSSFQLAALQRRFQNTQYLALPERAELAASLGLTQTQVK 182

  Fly   349 VWFQNRRTKHKRMQQEG 365
            :||||:|:|.|::.:.|
Zfish   183 IWFQNKRSKLKKIMKNG 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E5NP_524825.1 Homeobox 307..359 CDD:278475 25/51 (49%)
dlx5aNP_571381.2 DLL_N 31..118 CDD:289198 19/105 (18%)
Homeobox 140..193 CDD:278475 25/52 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0850
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.