DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E5 and dlx1a

DIOPT Version :9

Sequence 1:NP_524825.1 Gene:E5 / 45396 FlyBaseID:FBgn0008646 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_571380.1 Gene:dlx1a / 30568 ZFINID:ZDB-GENE-990415-48 Length:252 Species:Danio rerio


Alignment Length:217 Identity:60/217 - (27%)
Similarity:85/217 - (39%) Gaps:52/217 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   184 GPPHPPSQPPPFLAAQFQMAAALAHHHQQQQQQQQQQLPPVPTGPPHGPHPHLPPGQIPLGIFPG 248
            |||.....|.......:.|...    |.....|......|.|:.|...|:|:         :...
Zfish    24 GPPSQQMSPSSMTHGHYSMHCL----HSSGHPQHDSAYSPAPSFPRSLPYPY---------VNSV 75

  Fly   249 GPHPGHPPPHGHHPFGSAPHLIR-DSYPLYPWLLSRH----------------GRIFPRFPGNFL 296
            |.|            .|:|:|.. .:||....|....                |.:  ||.|.  
Zfish    76 GSH------------SSSPYLSTVQTYPNNSALAQTRLEDPAPESEKNTVVEGGEV--RFNGK-- 124

  Fly   297 FQPFRKPKRVRTAFSPTQLLKLEHAFEGNHYVVGAERKQLAQGLSLTETQVKVWFQNRRTKHKRM 361
            .:..|||   ||.:|..||..|...|:...|:...||.:||..|.||:||||:||||:|:|.|::
Zfish   125 GKKIRKP---RTIYSSLQLQALNRRFQQTQYLALPERAELAASLGLTQTQVKIWFQNKRSKFKKL 186

  Fly   362 QQEGGDGSDTK---SNKGSSSG 380
            .::||...||.   :.:|.|:|
Zfish   187 MKQGGGTIDTNALANGRGLSTG 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E5NP_524825.1 Homeobox 307..359 CDD:278475 25/51 (49%)
dlx1aNP_571380.1 COG5576 <124..233 CDD:227863 36/90 (40%)
Homeobox 131..184 CDD:278475 26/55 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0850
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.