DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E5 and dlx2b

DIOPT Version :9

Sequence 1:NP_524825.1 Gene:E5 / 45396 FlyBaseID:FBgn0008646 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_571372.1 Gene:dlx2b / 30557 ZFINID:ZDB-GENE-980526-18 Length:276 Species:Danio rerio


Alignment Length:113 Identity:41/113 - (36%)
Similarity:59/113 - (52%) Gaps:8/113 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   302 KPKRV---RTAFSPTQLLKLEHAFEGNHYVVGAERKQLAQGLSLTETQVKVWFQNRRTKHKRMQQ 363
            |||:|   ||.:|..||..|:..|:...|:...||.:||..|.||:||||:||||||:|.|::.:
Zfish   121 KPKKVRKPRTIYSSFQLAALQRRFQKTQYLALPERAELAASLGLTQTQVKIWFQNRRSKFKKLWK 185

  Fly   364 EGGDGSDTKSNKGSSSGGG----GGGD-GEDDAKHDGSQHSYEDAEDP 406
            .|...:|.:...|.|....    .|.| ..:..::||...|.:....|
Zfish   186 NGEIPADQQVASGDSPSSSPPPQAGWDFPPNPTQNDGDTVSEQPTGPP 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E5NP_524825.1 Homeobox 307..359 CDD:278475 26/51 (51%)
dlx2bNP_571372.1 DLL_N 29..102 CDD:289198
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 97..123 1/1 (100%)
Homeobox 128..181 CDD:278475 26/52 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 191..238 9/43 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0850
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.