DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E5 and emx2

DIOPT Version :9

Sequence 1:NP_524825.1 Gene:E5 / 45396 FlyBaseID:FBgn0008646 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_571355.2 Gene:emx2 / 30537 ZFINID:ZDB-GENE-990415-54 Length:247 Species:Danio rerio


Alignment Length:343 Identity:116/343 - (33%)
Similarity:137/343 - (39%) Gaps:138/343 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 PKLAFSIDSIVGESSTRSAPLRVSVISSPPPRSESPASPTNTNNSGRRTPRGYIYCRRRDSLDRS 112
            ||..|:|:|:|.:.:    ||       |..|||.|..|.                    :|..:
Zfish     6 PKRCFTIESLVAKDN----PL-------PSSRSEEPIRPA--------------------ALSYA 39

  Fly   113 RSPQRSPVSRSPSPPNAGGNPAAAGNTAKSGDPSSGTG---NPPTLIRPLPLPAPNLALIGNRTS 174
            .|.|.:|.                    .:|..|||.|   ||..:........||.|:      
Zfish    40 NSSQMNPF--------------------LNGFHSSGRGVYSNPGLVFAEAVSHPPNSAV------ 78

  Fly   175 PNAMAVRMAGPPHPPSQPPPFLAAQFQMAAALAHHHQQQQQQQQQQLPPVPTGPPHGPHPHLPPG 239
                      |.|  |.|||.         |||.|               |....|.|||.....
Zfish    79 ----------PVH--SVPPPH---------ALAAH---------------PLSSSHSPHPLFASQ 107

  Fly   240 QIPLGIFPGGPHPGHPPPHGHHPFGSAPHLIRDSYPLYPWLLSRHGRIFPRFPGN------FLFQ 298
            |                              ||....||||:.|:..:..||.||      ||..
Zfish   108 Q------------------------------RDPSTFYPWLIHRYRYLGHRFQGNETSPESFLLH 142

  Fly   299 P--FRKPKRVRTAFSPTQLLKLEHAFEGNHYVVGAERKQLAQGLSLTETQVKVWFQNRRTKHKR- 360
            .  .|||||:||||||:|||:||||||.|||||||||||||..||||||||||||||||||.|| 
Zfish   143 NALARKPKRIRTAFSPSQLLRLEHAFEKNHYVVGAERKQLAHSLSLTETQVKVWFQNRRTKFKRQ 207

  Fly   361 -MQQEGGDGSDTKSNKGS 377
             :::||.|....|  ||:
Zfish   208 KLEEEGSDSQQKK--KGT 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E5NP_524825.1 Homeobox 307..359 CDD:278475 46/51 (90%)
emx2NP_571355.2 Homeobox 153..205 CDD:278475 46/51 (90%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0850
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000921
OrthoInspector 1 1.000 - - mtm6489
orthoMCL 1 0.900 - - OOG6_109182
Panther 1 1.100 - - O PTHR24339
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3162
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
98.800

Return to query results.
Submit another query.