DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E5 and emx3

DIOPT Version :9

Sequence 1:NP_524825.1 Gene:E5 / 45396 FlyBaseID:FBgn0008646 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_571354.1 Gene:emx3 / 30536 ZFINID:ZDB-GENE-990415-53 Length:233 Species:Danio rerio


Alignment Length:375 Identity:110/375 - (29%)
Similarity:134/375 - (35%) Gaps:155/375 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 KLAFSIDSIVGESSTRSAPLRVSVISSPPPRSESPASPTNTNNSGRRTPRGYIYCRRRDSLDRSR 113
            |..|:|:|:||:.|           :|....::.|..||                          
Zfish     6 KKCFTIESLVGKDS-----------NSSNAAADEPIRPT-------------------------- 33

  Fly   114 SPQRSPVSRSPSPPNAGGNPAAAGNTAKSGDPSSGTGNPPTLIRPLPLPAPNLALIGNRTSPNAM 178
             ..|...|..|||  .|.....:|.|..|..|.....:|.|                        
Zfish    34 -ALRFTESIHPSP--FGSCFQNSGRTLYSSSPEMMFTDPST------------------------ 71

  Fly   179 AVRMAGPPHPPSQPPPFLAAQFQMAAALAHHHQQQQQQQQQQLPPVPTGPPHGPHPHLPPGQIPL 243
                    |..:             :.|:..|.|           :||.|...||.         
Zfish    72 --------HSTN-------------SGLSLRHLQ-----------IPTQPFFSPHQ--------- 95

  Fly   244 GIFPGGPHPGHPPPHGHHPFGSAPHLIRDSYPLYPWLLSRHGRIFPRFPGN-------FLFQPF- 300
                                       ||:...|||:| |:..:..||.|:       .|..|| 
Zfish    96 ---------------------------RDTLNFYPWVL-RNRYLGHRFQGDDSSPENLLLHGPFS 132

  Fly   301 RKPKRVRTAFSPTQLLKLEHAFEGNHYVVGAERKQLAQGLSLTETQVKVWFQNRRTKHKRMQQEG 365
            |||||:||||||:|||:||.|||.|||||||||||||.||.|||||||||||||||||||.:.|.
Zfish   133 RKPKRIRTAFSPSQLLRLERAFEKNHYVVGAERKQLANGLCLTETQVKVWFQNRRTKHKRQKLEE 197

  Fly   366 GDGSDTKSNKGSSSGGGGGGDGEDDAKHDGSQHSYEDAEDPEDEDEIEED 415
            ......:..|||              :|............|||.|.|.||
Zfish   198 ESPDPQQKRKGS--------------QHVSRWRVATQQGSPEDIDVISED 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E5NP_524825.1 Homeobox 307..359 CDD:278475 45/51 (88%)
emx3NP_571354.1 Homeobox 139..191 CDD:278475 45/51 (88%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 105 1.000 Domainoid score I6584
eggNOG 1 0.900 - - E1_KOG0850
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000921
OrthoInspector 1 1.000 - - mtm6489
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24339
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3162
SonicParanoid 1 1.000 - - X14
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
109.900

Return to query results.
Submit another query.