DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E5 and msx3

DIOPT Version :9

Sequence 1:NP_524825.1 Gene:E5 / 45396 FlyBaseID:FBgn0008646 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_571347.2 Gene:msx3 / 30526 ZFINID:ZDB-GENE-980526-306 Length:273 Species:Danio rerio


Alignment Length:261 Identity:71/261 - (27%)
Similarity:99/261 - (37%) Gaps:66/261 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 SPVSRSPSPPNAGGNPAAAG--NTAKSGDPSSGTGNPPTLI-----RPLPLPAPNLALIGNRTSP 175
            :|:|   |..|:.|..:..|  ...||.|......|....:     :.|.||....:||.:|||.
Zfish     2 APLS---SMMNSEGPLSQEGKLQERKSADKEDAQSNDKAAVKGCKGKALSLPFSVESLISDRTSS 63

  Fly   176 NAMAVRM-AGPPHPPS-------QPPPFLAAQFQMAAALAHHHQQQQQQQQQQLPPVPTGPPHGP 232
            ..:.... ||...|.|       ..|..|.|..::......:....::...::|.          
Zfish    64 RTLYTSSEAGIISPTSGADERLKLSPMALYADRKIPVESVSNLSDCKRGDMEELS---------- 118

  Fly   233 HPHLPPGQIPLGIFPGGPHPGHPPPHGHHPFGSAPHLIRDSYPLYPWLLSRHGRIFPRFPGNFLF 297
                ..||  .|.|....:.. ||.|...|               |..|.:|             
Zfish   119 ----DKGQ--SGWFQTTSYTS-PPRHSSPP---------------PCTLRKH------------- 148

  Fly   298 QPFRKPKRVRTAFSPTQLLKLEHAFEGNHYVVGAERKQLAQGLSLTETQVKVWFQNRRTKHKRMQ 362
            :..|||   ||.|:.:|||.||..|....|:..|||.:.:..|:|||||||:||||||.|.||:|
Zfish   149 KNNRKP---RTPFTTSQLLALERKFRQKQYLSIAERAEFSNSLNLTETQVKIWFQNRRAKAKRLQ 210

  Fly   363 Q 363
            :
Zfish   211 E 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E5NP_524825.1 Homeobox 307..359 CDD:278475 28/51 (55%)
msx3NP_571347.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 114..159 17/92 (18%)
Homeobox 154..207 CDD:278475 29/55 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0850
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.