DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E5 and hoxc11a

DIOPT Version :10

Sequence 1:NP_524825.1 Gene:E5 / 45396 FlyBaseID:FBgn0008646 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_571240.1 Gene:hoxc11a / 30403 ZFINID:ZDB-GENE-990415-111 Length:306 Species:Danio rerio


Alignment Length:63 Identity:25/63 - (39%)
Similarity:42/63 - (66%) Gaps:0/63 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   302 KPKRVRTAFSPTQLLKLEHAFEGNHYVVGAERKQLAQGLSLTETQVKVWFQNRRTKHKRMQQE 364
            :.::.|..:|..|:.:||..|..|.|:...:|.||::.|:||:.|||:||||||.|.|::.::
Zfish   233 RTRKKRCPYSKFQIRELEREFFFNVYINKEKRLQLSRMLNLTDRQVKIWFQNRRMKEKKLSRD 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E5NP_524825.1 Homeodomain 304..360 CDD:459649 24/55 (44%)
hoxc11aNP_571240.1 DUF3528 42..167 CDD:432284
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 177..238 0/4 (0%)
Homeodomain 235..291 CDD:459649 24/55 (44%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.