DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E5 and Cdx4

DIOPT Version :9

Sequence 1:NP_524825.1 Gene:E5 / 45396 FlyBaseID:FBgn0008646 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_001100412.1 Gene:Cdx4 / 302400 RGDID:1561529 Length:288 Species:Rattus norvegicus


Alignment Length:308 Identity:72/308 - (23%)
Similarity:102/308 - (33%) Gaps:121/308 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 NAGGNPAAAGNTAKSGDPSSGTGNPPTLIRPLPLPAPNLALIGNRTSPNAMAVRMAGPPHPPSQP 192
            |.||     |:||..| .|.|:|:        ||||.|..               |.|.:|    
  Rat    20 NPGG-----GSTAGVG-TSGGSGS--------PLPASNFT---------------AAPVYP---- 51

  Fly   193 PPFLAAQFQMAAALAHHHQQQQQQQQQQLPPVPTGPPHGP------HPHLPP------------- 238
                            |:        ...|.:....||||      .|:.||             
  Rat    52 ----------------HY--------MGYPHMSNMDPHGPSLGAWSSPYSPPREDWSTYPGPSST 92

  Fly   239 -GQIPLG-IFPGGPHPGHP--------------PPHGHHPFGSAPHLI--------------RDS 273
             |.:|:. :....|..|.|              ...|..|..::..|:              |..
  Rat    93 MGTVPMNDMTSSSPAFGSPDYSTLGPTGGAGGASNGGSLPDAASESLVSIDSGTSGGATSPSRSR 157

  Fly   274 YPLYPWLLSRHGRIFPRFPGNFLFQPFRKPKRVRTAFSPTQLLKLEHAFEGNHYVVGAERKQLAQ 338
            :..|.|:     |...:..|.     .|..::.|..::..|.|:||..|..|.|:....:.:||.
  Rat   158 HSPYAWM-----RKTVQVTGK-----TRTKEKYRVVYTDHQRLELEKEFHCNRYITIRRKSELAV 212

  Fly   339 GLSLTETQVKVWFQNRRTKHKRM-----QQEGGDGSDTKSNKGSSSGG 381
            .|.|:|.|||:||||||.|.::|     .|....|...:|:.||.|.|
  Rat   213 NLGLSERQVKIWFQNRRAKERKMIKKKISQFENSGGSVQSDSGSISPG 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E5NP_524825.1 Homeobox 307..359 CDD:278475 23/51 (45%)
Cdx4NP_001100412.1 Caudal_act 13..166 CDD:398418 38/207 (18%)
Homeobox 181..234 CDD:395001 23/52 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0850
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.