DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E5 and Dlx1

DIOPT Version :9

Sequence 1:NP_524825.1 Gene:E5 / 45396 FlyBaseID:FBgn0008646 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_001094001.1 Gene:Dlx1 / 296500 RGDID:1309593 Length:255 Species:Rattus norvegicus


Alignment Length:235 Identity:65/235 - (27%)
Similarity:88/235 - (37%) Gaps:65/235 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   184 GPPHPPSQPPPFLAAQFQMAAALAHHHQQQQQQQQQQLPPVPTGPPHGPHPHLPPGQIPLGIFPG 248
            |||:....|.|.....:.|....:..|.|                |.|.:........|||.   
  Rat    24 GPPNQQMSPSPMSHGHYSMHCLHSAGHSQ----------------PDGAYSSASSFSRPLGY--- 69

  Fly   249 GPHPGHPPPHGHHPFGSAPHLIRDSYPLYPWLLSRH----------------GRIFPRFPGNFLF 297
             |:......|...|:.|:.    .|||....|....                |.:  ||.|.  .
  Rat    70 -PYVNSVSSHASSPYISSV----QSYPGSASLAQSRLEDPGADSEKSTVVEGGEV--RFNGK--G 125

  Fly   298 QPFRKPKRVRTAFSPTQLLKLEHAFEGNHYVVGAERKQLAQGLSLTETQVKVWFQNRRTKHKRMQ 362
            :..|||   ||.:|..||..|...|:...|:...||.:||..|.||:||||:||||:|:|.|::.
  Rat   126 KKIRKP---RTIYSSLQLQALNRRFQQTQYLALPERAELAASLGLTQTQVKIWFQNKRSKFKKLM 187

  Fly   363 QEGG---DGSDTKS---------------NKGSSSGGGGG 384
            ::||   :||...:               |..||||.|.|
  Rat   188 KQGGAALEGSALANGRALSAGSPPVPPGWNPNSSSGKGSG 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E5NP_524825.1 Homeobox 307..359 CDD:278475 25/51 (49%)
Dlx1NP_001094001.1 Homeobox 131..185 CDD:395001 26/56 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0850
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.