DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E5 and Dlx2

DIOPT Version :9

Sequence 1:NP_524825.1 Gene:E5 / 45396 FlyBaseID:FBgn0008646 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_001178675.1 Gene:Dlx2 / 296499 RGDID:1304853 Length:332 Species:Rattus norvegicus


Alignment Length:381 Identity:88/381 - (23%)
Similarity:114/381 - (29%) Gaps:173/381 - (45%)


- Green bases have known domain annotations that are detailed below.


  Fly   201 QMAAALAHHHQQQQQQQQQQLPPVPTGPP--------------HGPH--PHLPPG---------- 239
            |:.|:..:|..||        ||...|..              |.|.  |.||..          
  Rat    16 QITASSTYHQHQQ--------PPSGAGAGSGGSSNSSSSNSNLHKPQESPTLPVSTATDSSYYTN 72

  Fly   240 -QIPLGIFPGGPHP-GHPPPHGHH---------------------------PFGSAPHLIR---D 272
             |.|.|...||..| .|...:.:|                           |:|::...:.   |
  Rat    73 QQHPAGGGGGGASPYAHMGSYQYHASGLNNVSYSAKSSYDLGYTAAYTSYAPYGTSSSPVNNEPD 137

  Fly   273 SYPLYPWLLSRHGRIFPRFPGNFLFQPFRKPKRV---RTAFSPTQLLKLEHAFEGNHYVVGAERK 334
            ...|.|.:...:|                |||:|   ||.:|..||..|:..|:...|:...||.
  Rat   138 KEDLEPEIRIVNG----------------KPKKVRKPRTIYSSFQLAALQRRFQKTQYLALPERA 186

  Fly   335 QLAQGLSLTETQVKVWFQNRRTKHKRMQQEGGDGSDTKSNKGSSS-------------------- 379
            :||..|.||:||||:||||||:|.|:|.:.|  ...|:.:.|:|:                    
  Rat   187 ELAASLGLTQTQVKIWFQNRRSKFKKMWKSG--EIPTEQHPGASASPPCASPPVSAPASWDFGAQ 249

  Fly   380 ---GGGGGGDGEDDAKHDGSQHS------------YEDAEDPEDEDEIEEDDEDEVIDMDDYGSE 429
               .|||.|.|...|...||..|            |..|.                      || 
  Rat   250 QRMAGGGPGSGGSGAGSSGSSPSSAASAFLGNYPWYHQAS----------------------GS- 291

  Fly   430 MDAEEHQRLREQFQQQLAQHQQQFMQQNAGEAATLSPQQQHQLLQQHQQHLQQQHH 485
                             |.|.|       ..|..|.|.|..|....|..|    ||
  Rat   292 -----------------ASHLQ-------ATAPLLHPSQTPQAHHHHHHH----HH 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E5NP_524825.1 Homeobox 307..359 CDD:278475 26/51 (51%)
Dlx2NP_001178675.1 DLL_N 54..135 CDD:289198 13/80 (16%)
Homeobox 158..211 CDD:278475 26/52 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0850
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.