DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E5 and Obox5

DIOPT Version :9

Sequence 1:NP_524825.1 Gene:E5 / 45396 FlyBaseID:FBgn0008646 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_663755.2 Gene:Obox5 / 252829 MGIID:2149035 Length:291 Species:Mus musculus


Alignment Length:120 Identity:33/120 - (27%)
Similarity:55/120 - (45%) Gaps:21/120 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   301 RKPKRVRTAFSPTQLLKLEHAFEGNHYVVGAERKQLAQGLSLTETQVKVWFQNRRTKHKRMQQEG 365
            ||.::.||.::..|...|:..|:...|....:..:||..:.:|:.::|:||:|.|.|::||..:.
Mouse    92 RKFRKERTVYTKEQQRLLQKHFDECQYPNEKKIMELAVSVGVTKMEIKIWFKNNRAKYRRMNLQN 156

  Fly   366 GDGSDTKSN------------KGS----SSGGG----GGGDGEDD-AKHDGSQHS 399
            ...:..:||            .||    :|..|    .|..|||. .|.:.||.|
Mouse   157 IKQALPESNGISKAVSESTHFPGSIPVVASDNGESMCSGTFGEDSMPKFNCSQES 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E5NP_524825.1 Homeobox 307..359 CDD:278475 15/51 (29%)
Obox5NP_663755.2 homeodomain 95..153 CDD:238039 16/57 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0850
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.