DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E5 and Shox2

DIOPT Version :10

Sequence 1:NP_524825.1 Gene:E5 / 45396 FlyBaseID:FBgn0008646 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_038693.1 Gene:Shox2 / 20429 MGIID:1201673 Length:331 Species:Mus musculus


Alignment Length:63 Identity:27/63 - (42%)
Similarity:41/63 - (65%) Gaps:0/63 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   302 KPKRVRTAFSPTQLLKLEHAFEGNHYVVGAERKQLAQGLSLTETQVKVWFQNRRTKHKRMQQE 364
            |.:|.||.|:..||.:||..|:..||.....|::|:|.|.|:|.:|:|||||||.|.::.:.:
Mouse   139 KQRRSRTNFTLEQLNELERLFDETHYPDAFMREELSQRLGLSEARVQVWFQNRRAKCRKQENQ 201

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
E5NP_524825.1 Homeodomain 304..360 CDD:459649 26/55 (47%)
Shox2NP_038693.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20