DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E5 and EMX2

DIOPT Version :9

Sequence 1:NP_524825.1 Gene:E5 / 45396 FlyBaseID:FBgn0008646 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_004089.1 Gene:EMX2 / 2018 HGNCID:3341 Length:252 Species:Homo sapiens


Alignment Length:340 Identity:120/340 - (35%)
Similarity:141/340 - (41%) Gaps:127/340 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 PKLAFSIDSIVGESSTRSAPLRVSVISSPPPRSESPASPTNTNNSGRRTPRGYIYCRRRDSLDRS 112
            ||..|:|:|:|.:.|    ||       |..|||.|..|.                    :|..:
Human     6 PKRCFTIESLVAKDS----PL-------PASRSEDPIRPA--------------------ALSYA 39

  Fly   113 RSPQRSPVSRSPSPPNAGGNPAAAGNTAKSGDPSSGTGNPPTLIRPLPLPAPNLALIGNRTSPNA 177
            .|        ||..|...|..:||...|..|..|    ||..:........||.|:         
Human    40 NS--------SPINPFLNGFHSAAAAAAGRGVYS----NPDLVFAEAVSHPPNPAV--------- 83

  Fly   178 MAVRMAGPPHPPSQPPPFLAAQFQMAAALAHHHQQQQQQQQQQLPPVPTGPPHGPHPHLPPGQIP 242
                   |.||  .|||.         |||.|             |:|:.  |.|||.....|  
Human    84 -------PVHP--VPPPH---------ALAAH-------------PLPSS--HSPHPLFASQQ-- 113

  Fly   243 LGIFPGGPHPGHPPPHGHHPFGSAPHLIRDSYPLYPWLLSRHGRIFPRFPGN------FLFQP-- 299
                                        ||....||||:.|:..:..||.||      ||...  
Human   114 ----------------------------RDPSTFYPWLIHRYRYLGHRFQGNDTSPESFLLHNAL 150

  Fly   300 FRKPKRVRTAFSPTQLLKLEHAFEGNHYVVGAERKQLAQGLSLTETQVKVWFQNRRTKHKR--MQ 362
            .|||||:||||||:|||:||||||.|||||||||||||..||||||||||||||||||.||  ::
Human   151 ARKPKRIRTAFSPSQLLRLEHAFEKNHYVVGAERKQLAHSLSLTETQVKVWFQNRRTKFKRQKLE 215

  Fly   363 QEGGDGSDTKSNKGS 377
            :||.|....|  ||:
Human   216 EEGSDSQQKK--KGT 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E5NP_524825.1 Homeobox 307..359 CDD:278475 46/51 (90%)
EMX2NP_004089.1 Homeobox 158..211 CDD:395001 46/52 (88%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 212..252 6/19 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 104 1.000 Domainoid score I6707
eggNOG 1 0.900 - - E1_KOG0850
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 158 1.000 Inparanoid score I4276
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000921
OrthoInspector 1 1.000 - - mtm8552
orthoMCL 1 0.900 - - OOG6_109182
Panther 1 1.100 - - O PTHR24339
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3162
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
109.890

Return to query results.
Submit another query.