DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E5 and EMX1

DIOPT Version :9

Sequence 1:NP_524825.1 Gene:E5 / 45396 FlyBaseID:FBgn0008646 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_004088.2 Gene:EMX1 / 2016 HGNCID:3340 Length:290 Species:Homo sapiens


Alignment Length:283 Identity:109/283 - (38%)
Similarity:132/283 - (46%) Gaps:43/283 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 RDSLDRSRSPQRSPVSRSPSPPNAGGNPAAAGNTAKSGDPSSGTGNPPTLIRPLPLPAPNLALIG 170
            |.:|.|:|.|:.:|.:.:...|.|..........||.|....|||.          ......|:.
Human    16 RGALPRARLPRTAPAAATMFQPAAKRGFTIESLVAKDGGTGGGTGG----------GGAGSHLLA 70

  Fly   171 NRTSPNAMAVRMAGPPHPPSQPPPFLAAQFQMAAALAHHHQQQQQQQQQQLPPVPTGPPHGPHPH 235
            ...|...:.......|||.:....|::. |. |||.|...:......:...|.....|....||.
Human    71 AAASEEPLRPTALNYPHPSAAEAAFVSG-FP-AAAAAGAGRSLYGGPELVFPEAMNHPALTVHPA 133

  Fly   236 LPPGQIPLGIFPGGPHPGHPPPHGHHPFGSAPHLIRDSYPLYPWLLSRHGRIF-PRF-------P 292
            ...|..||          .||    |.|..|.|  ||....|||:|  ..|.| .||       .
Human   134 HQLGASPL----------QPP----HSFFGAQH--RDPLHFYPWVL--RNRFFGHRFQASDVPQD 180

  Fly   293 GNFLFQPF-RKPKRVRTAFSPTQLLKLEHAFEGNHYVVGAERKQLAQGLSLTETQVKVWFQNRRT 356
            |..|..|| |||||:||||||:|||:||.|||.|||||||||||||..|||:|||||||||||||
Human   181 GLLLHGPFARKPKRIRTAFSPSQLLRLERAFEKNHYVVGAERKQLAGSLSLSETQVKVWFQNRRT 245

  Fly   357 KHKR--MQQEGGDGSDTKSNKGS 377
            |:||  :::||.:....|  |||
Human   246 KYKRQKLEEEGPESEQKK--KGS 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E5NP_524825.1 Homeobox 307..359 CDD:278475 44/51 (86%)
EMX1NP_004088.2 COG5576 140..>251 CDD:227863 73/128 (57%)
Homeobox 196..248 CDD:278475 44/51 (86%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 216..257 31/40 (78%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 104 1.000 Domainoid score I6707
eggNOG 1 0.900 - - E1_KOG0850
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 158 1.000 Inparanoid score I4276
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000921
OrthoInspector 1 1.000 - - mtm8552
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR24339
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3162
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
109.950

Return to query results.
Submit another query.