DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E5 and ceh-2

DIOPT Version :9

Sequence 1:NP_524825.1 Gene:E5 / 45396 FlyBaseID:FBgn0008646 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_491746.1 Gene:ceh-2 / 191615 WormBaseID:WBGene00000429 Length:209 Species:Caenorhabditis elegans


Alignment Length:120 Identity:69/120 - (57%)
Similarity:78/120 - (65%) Gaps:14/120 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   277 YPWLLSRHGRIFPRF----PGNFLFQPFRKPKRVRTAFSPTQLLKLEHAFEGNHYVVGAERKQLA 337
            :|||.........:|    .|.|| ||.||.||:|||||.:||::||.||||||||||.||||||
 Worm    97 HPWLELLQSTTAAQFGDVTAGLFL-QPLRKNKRIRTAFSASQLIQLEKAFEGNHYVVGNERKQLA 160

  Fly   338 QGLSLTETQVKVWFQNRRTKHKRMQQEGGDGSDTKSNKGSSSGGGGGGDGEDDAK 392
            ..|||||||||||||||||||||::.||.|.:...||         ..|.|||.|
 Worm   161 AKLSLTETQVKVWFQNRRTKHKRVRLEGSDPNAPMSN---------DEDDEDDKK 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E5NP_524825.1 Homeobox 307..359 CDD:278475 43/51 (84%)
ceh-2NP_491746.1 Homeobox 130..182 CDD:278475 43/51 (84%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160160007
Domainoid 1 1.000 100 1.000 Domainoid score I4406
eggNOG 1 0.900 - - E1_KOG0850
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000921
OrthoInspector 1 1.000 - - otm14654
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR24339
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3162
SonicParanoid 1 1.000 - - X14
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1110.830

Return to query results.
Submit another query.