DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E5 and Msx3

DIOPT Version :9

Sequence 1:NP_524825.1 Gene:E5 / 45396 FlyBaseID:FBgn0008646 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_034966.1 Gene:Msx3 / 17703 MGIID:106587 Length:204 Species:Mus musculus


Alignment Length:148 Identity:57/148 - (38%)
Similarity:69/148 - (46%) Gaps:37/148 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   230 HGPHPH-----LPPGQIP------LGIFP--GGPHPG-HPPPHGHHPFGSAPHLIRDSYPLYPWL 280
            |||.|.     |...::|      ||:..  |...|| .|||..|.....||     |.|  |..
Mouse    23 HGPLPFSVESLLEAERVPGSESGELGVERPLGASKPGAWPPPVAHSCPPRAP-----SPP--PCT 80

  Fly   281 LSRHGRIFPRFPGNFLFQPFRKPKRVRTAFSPTQLLKLEHAFEGNHYVVGAERKQLAQGLSLTET 345
            |.:|             :..|||   ||.|:..|||.||..|....|:..|||.:.:..||||||
Mouse    81 LRKH-------------KTNRKP---RTPFTTAQLLALERKFHQKQYLSIAERAEFSSSLSLTET 129

  Fly   346 QVKVWFQNRRTKHKRMQQ 363
            |||:||||||.|.||:|:
Mouse   130 QVKIWFQNRRAKAKRLQE 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E5NP_524825.1 Homeobox 307..359 CDD:278475 29/51 (57%)
Msx3NP_034966.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 39..89 17/69 (25%)
Homeobox 90..143 CDD:278475 30/55 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0850
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.