DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E5 and Msx2

DIOPT Version :9

Sequence 1:NP_524825.1 Gene:E5 / 45396 FlyBaseID:FBgn0008646 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_038629.2 Gene:Msx2 / 17702 MGIID:97169 Length:267 Species:Mus musculus


Alignment Length:236 Identity:70/236 - (29%)
Similarity:97/236 - (41%) Gaps:52/236 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   141 KSGDP-SSGTGNPPTLIRPLPLPAPNLALIGNRTSPNAMAVRMAGPPHPPSQPPPFLAAQFQMAA 204
            |.||. ||....|..|..|.|.|.      |...|.....|:::..|             |.:.|
Mouse     6 KGGDLFSSDEEGPAVLAGPGPGPG------GAEGSAEERRVKVSSLP-------------FSVEA 51

  Fly   205 ALAHHHQQQQQQQQQQLPPVPTGPPHGPHPHLPP-----GQI--PLGIFPG-GPHPGHPPPHGHH 261
            .::           .:.||..:       |.:||     |.:  || :.|| |....|.|.....
Mouse    52 LMS-----------DKKPPKES-------PAVPPDCASAGAVLRPL-LLPGHGVRDAHSPGPLVK 97

  Fly   262 PFGSAPHLIRDSYPLYPWLLSRHGRIFP----RFPGNFLFQPFRKPKRVRTAFSPTQLLKLEHAF 322
            ||.:|.....:|....|| :...||..|    ..|.....:..:..::.||.|:.:|||.||..|
Mouse    98 PFETASVKSENSEDGAPW-IQEPGRYSPPPRHMSPTTCTLRKHKTNRKPRTPFTTSQLLALERKF 161

  Fly   323 EGNHYVVGAERKQLAQGLSLTETQVKVWFQNRRTKHKRMQQ 363
            ....|:..|||.:.:..|:|||||||:||||||.|.||:|:
Mouse   162 RQKQYLSIAERAEFSSSLNLTETQVKIWFQNRRAKAKRLQE 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E5NP_524825.1 Homeobox 307..359 CDD:278475 28/51 (55%)
Msx2NP_038629.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..42 13/41 (32%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 104..132 6/28 (21%)
Homeobox 145..198 CDD:306543 28/52 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0850
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.