DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E5 and pal-1

DIOPT Version :9

Sequence 1:NP_524825.1 Gene:E5 / 45396 FlyBaseID:FBgn0008646 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_001021209.1 Gene:pal-1 / 175638 WormBaseID:WBGene00003912 Length:270 Species:Caenorhabditis elegans


Alignment Length:291 Identity:70/291 - (24%)
Similarity:92/291 - (31%) Gaps:106/291 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 PQRSPVSRSPSPPNAGGNPAAAGNTAKSGDPSSGTGNPPTLIRPLPLPAPNLALIGNRTSPNAMA 179
            |.|..:.:....|...|..:..|:|...|.|.         :.|..||    .|..|...|...|
 Worm    42 PLREKMLQPTFDPQIYGRWSQMGDTGFYGHPD---------LYPFGLP----QLAANGQIPAVEA 93

  Fly   180 VRMAGP-------------PHPPSQPPPF------------------LAAQFQMAAALAHHHQ-- 211
            |.:..|             |.|.....||                  .||.:||.||..:...  
 Worm    94 VDVKPPLSNGSSSSDSGMYPSPSDMMTPFPSTSSGAASSSELSAAAAAAANYQMRAATCYQQSVW 158

  Fly   212 --QQQQQQQQQLPPVPTGPPHGPHPHLPPGQIPLGIFPGGPHPGHPPPHGHHPFGSAPHLIRDSY 274
              ...||.|.....:|.|..||..                                     |.| 
 Worm   159 PFMDYQQFQGFSWKMPLGNNHGKD-------------------------------------RRS- 185

  Fly   275 PLYPWLLSRHGRIFPRFPGNFLFQPFRKPKRVRTA------FSPTQLLKLEHAFEGNHYVVGAER 333
                   |..|:..|..||.       ...|||||      :|..|.|:||..|..:.::....:
 Worm   186 -------SSDGKTLPTGPGT-------NNVRVRTADKYRMVYSDYQRLELEKEFHTSPFITSDRK 236

  Fly   334 KQLAQGLSLTETQVKVWFQNRRTKHKRMQQE 364
            .||:..|||||.|:|:||||||.|.:|.:|:
 Worm   237 SQLSTMLSLTERQIKIWFQNRRAKDRRDKQK 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E5NP_524825.1 Homeobox 307..359 CDD:278475 25/57 (44%)
pal-1NP_001021209.1 Homeobox 210..262 CDD:278475 22/51 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.