Sequence 1: | NP_524825.1 | Gene: | E5 / 45396 | FlyBaseID: | FBgn0008646 | Length: | 524 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_005213.3 | Gene: | DLX6 / 1750 | HGNCID: | 2919 | Length: | 293 | Species: | Homo sapiens |
Alignment Length: | 217 | Identity: | 73/217 - (33%) |
---|---|---|---|
Similarity: | 96/217 - (44%) | Gaps: | 55/217 - (25%) |
- Green bases have known domain annotations that are detailed below.
Fly 211 QQQQQQQQQQLPPVPTGPPHGPH-----PHLPPGQIPL-------GIFPGGPHPGHPPPHGHH-- 261
Fly 262 PFGSA-----PHLIRDSYPLY------PWLLSRH-----------------------GRIFPRFP 292
Fly 293 GNFLFQPFRKPKRVRTAFSPTQLLKLEHAFEGNHYVVGAERKQLAQGLSLTETQVKVWFQNRRTK 357
Fly 358 HKRMQQEGGDGSDTKSNKGSSS 379 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
E5 | NP_524825.1 | Homeobox | 307..359 | CDD:278475 | 26/51 (51%) |
DLX6 | NP_005213.3 | COG5576 | 119..>231 | CDD:227863 | 40/118 (34%) |
Homeobox | 170..223 | CDD:278475 | 27/55 (49%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG0850 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |