DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E5 and DLX6

DIOPT Version :9

Sequence 1:NP_524825.1 Gene:E5 / 45396 FlyBaseID:FBgn0008646 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_005213.3 Gene:DLX6 / 1750 HGNCID:2919 Length:293 Species:Homo sapiens


Alignment Length:217 Identity:73/217 - (33%)
Similarity:96/217 - (44%) Gaps:55/217 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   211 QQQQQQQQQQLPPVPTGPPHGPH-----PHLPPGQIPL-------GIFPGGPHPGHPPPHGHH-- 261
            ||||||||||.||.|..||..||     |.:.....||       .....|.|..|...|.||  
Human    34 QQQQQQQQQQQPPPPPPPPPQPHSQQSSPAMAGAHYPLHCLHSAAAAAAAGSHHHHHHQHHHHGS 98

  Fly   262 PFGSA-----PHLIRDSYPLY------PWLLSRH-----------------------GRIFPRFP 292
            |:.|.     .|....:||..      |:|.|.|                       |.|  ||.
Human    99 PYASGGGNSYNHRSLAAYPYMSHSQHSPYLQSYHNSSAAAQTRGDDTDQQKTTVIENGEI--RFN 161

  Fly   293 GNFLFQPFRKPKRVRTAFSPTQLLKLEHAFEGNHYVVGAERKQLAQGLSLTETQVKVWFQNRRTK 357
            |.  .:..|||   ||.:|..||..|.|.|:...|:...||.:||..|.||:||||:||||:|:|
Human   162 GK--GKKIRKP---RTIYSSLQLQALNHRFQQTQYLALPERAELAASLGLTQTQVKIWFQNKRSK 221

  Fly   358 HKRMQQEGGDGSDTKSNKGSSS 379
            .|::.::|.:..::...:||::
Human   222 FKKLLKQGSNPHESDPLQGSAA 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E5NP_524825.1 Homeobox 307..359 CDD:278475 26/51 (51%)
DLX6NP_005213.3 COG5576 119..>231 CDD:227863 40/118 (34%)
Homeobox 170..223 CDD:278475 27/55 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0850
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.