DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E5 and DLX3

DIOPT Version :9

Sequence 1:NP_524825.1 Gene:E5 / 45396 FlyBaseID:FBgn0008646 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_005211.1 Gene:DLX3 / 1747 HGNCID:2916 Length:287 Species:Homo sapiens


Alignment Length:205 Identity:57/205 - (27%)
Similarity:80/205 - (39%) Gaps:51/205 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   234 PHLPPGQI-PLGIFPGGPH---PGHP------PPHGHHPF------GSAPHLIRDSYPLYPWLLS 282
            |.||...: .||.:....|   .|.|      |...||.|      |:..:..:..|        
Human    30 PTLPESSVTDLGYYSAPQHDYYSGQPYGQTVNPYTYHHQFNLNGLAGTGAYSPKSEY-------- 86

  Fly   283 RHGRIFPRFPGNFLFQPF--------------------RKPKRV---RTAFSPTQLLKLEHAFEG 324
            .:|..:.:: |.:..||.                    .|||:|   ||.:|..||..|:..|:.
Human    87 TYGASYRQY-GAYREQPLPAQDPVSVKEEPEAEVRMVNGKPKKVRKPRTIYSSYQLAALQRRFQK 150

  Fly   325 NHYVVGAERKQLAQGLSLTETQVKVWFQNRRTKHKRMQQEGGDGSDTKSNKGSSSGGGGGGDGED 389
            ..|:...||.:||..|.||:||||:||||||:|.|::.:.|....:...|...|.   .......
Human   151 AQYLALPERAELAAQLGLTQTQVKIWFQNRRSKFKKLYKNGEVPLEHSPNNSDSM---ACNSPPS 212

  Fly   390 DAKHDGSQHS 399
            .|..|.|.||
Human   213 PALWDTSSHS 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E5NP_524825.1 Homeobox 307..359 CDD:278475 26/51 (51%)
DLX3NP_005211.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 20..39 3/8 (38%)
DLL_N 27..107 CDD:403572 18/85 (21%)
COG5576 <109..232 CDD:227863 39/117 (33%)
homeobox 129..188 28/58 (48%)
Homeobox 132..186 CDD:395001 26/53 (49%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 195..287 7/31 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0850
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.