DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E5 and DLX2

DIOPT Version :9

Sequence 1:NP_524825.1 Gene:E5 / 45396 FlyBaseID:FBgn0008646 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_004396.1 Gene:DLX2 / 1746 HGNCID:2915 Length:328 Species:Homo sapiens


Alignment Length:277 Identity:76/277 - (27%)
Similarity:102/277 - (36%) Gaps:100/277 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   201 QMAAALAHHHQQQQQQQQQQLPPVPTGPPHGP---------------HPHLPPG----------- 239
            |:||:..:|..||.          |:|...||               .|.||..           
Human    16 QIAASSTYHQHQQP----------PSGGGAGPGGNSSSSSSLHKPQESPTLPVSTATDSSYYTNQ 70

  Fly   240 QIPLGIFPGGPHPGHPPPH-GHHPF-----GSAPHLIRDSYPL---------YPWLLSRHGRIFP 289
            |.|.|   ||...|.|..| |.:.:     .:.|:..:.||.|         .|:..|..     
Human    71 QHPAG---GGGGGGSPYAHMGSYQYQASGLNNVPYSAKSSYDLGYTAAYTSYAPYGTSSS----- 127

  Fly   290 RFPGNFLFQPFR------------KPKRV---RTAFSPTQLLKLEHAFEGNHYVVGAERKQLAQG 339
              |.|  .:|.:            |||:|   ||.:|..||..|:..|:...|:...||.:||..
Human   128 --PAN--NEPEKEDLEPEIRIVNGKPKKVRKPRTIYSSFQLAALQRRFQKTQYLALPERAELAAS 188

  Fly   340 LSLTETQVKVWFQNRRTKHKRMQQEGGDGSDTKSNKGSS----------------------SGGG 382
            |.||:||||:||||||:|.|:|.:.|...|:......:|                      :|||
Human   189 LGLTQTQVKIWFQNRRSKFKKMWKSGEIPSEQHPGASASPPCASPPVSAPASWDFGVPQRMAGGG 253

  Fly   383 GGGDGEDDAKHDGSQHS 399
            |.|.|...|...||..|
Human   254 GPGSGGSGAGSSGSSPS 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E5NP_524825.1 Homeobox 307..359 CDD:278475 26/51 (51%)
DLX2NP_004396.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 16..81 18/77 (23%)
DLL_N 51..132 CDD:289198 20/92 (22%)
Homeobox 155..208 CDD:278475 26/52 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 211..270 12/58 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 300..328
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0850
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.