Sequence 1: | NP_524825.1 | Gene: | E5 / 45396 | FlyBaseID: | FBgn0008646 | Length: | 524 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_835221.2 | Gene: | DLX1 / 1745 | HGNCID: | 2914 | Length: | 255 | Species: | Homo sapiens |
Alignment Length: | 237 | Identity: | 66/237 - (27%) |
---|---|---|---|
Similarity: | 90/237 - (37%) | Gaps: | 65/237 - (27%) |
- Green bases have known domain annotations that are detailed below.
Fly 184 GPPHPPSQPPPFLAAQFQMAAALAHHHQQQQQQQQQQLPPVPTGPPHGPHPHLPPGQIPLGIFPG 248
Fly 249 GPHPGHPPPHGHHPFGSAPHLIRDSYPLYPWLLSRH----------------GRIFPRFPGNFLF 297
Fly 298 QPFRKPKRVRTAFSPTQLLKLEHAFEGNHYVVGAERKQLAQGLSLTETQVKVWFQNRRTKHKRMQ 362
Fly 363 QEGG---DGSDTKS---------------NKGSSSGGGGGGD 386 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
E5 | NP_524825.1 | Homeobox | 307..359 | CDD:278475 | 25/51 (49%) |
DLX1 | NP_835221.2 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..38 | 5/13 (38%) | |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 95..118 | 1/22 (5%) | |||
Homeobox | 131..185 | CDD:395001 | 26/56 (46%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 204..230 | 8/26 (31%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG0850 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |