DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E5 and ceh-12

DIOPT Version :10

Sequence 1:NP_524825.1 Gene:E5 / 45396 FlyBaseID:FBgn0008646 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_491693.1 Gene:ceh-12 / 172255 WormBaseID:WBGene00000436 Length:180 Species:Caenorhabditis elegans


Alignment Length:106 Identity:22/106 - (20%)
Similarity:31/106 - (29%) Gaps:48/106 - (45%)


- Green bases have known domain annotations that are detailed below.


  Fly   435 FTALKVYREGSEFG---------------PVKYSLGYAFRGGNKDAMLQLHSSETSDAQPFWIYK 484
            |..|::.|.|..||               ||::.|.                  |.|.|      
 Worm   224 FFRLQLGRSGKWFGRRVCNTEQVHGWDIKPVRFQLW------------------TEDGQ------ 264

  Fly   485 LGPEGKNSFGDSQYEYAIISNWVKYPV-TVLVRDPDTFKTK 524
                    :..||.......||:.|.. .|:||:.:...||
 Worm   265 --------YSSSQCMLTERGNWIHYHAGDVVVRESNRSSTK 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E5NP_524825.1 Homeodomain 304..360 CDD:459649
ceh-12NP_491693.1 Homeodomain 111..167 CDD:459649
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.